ESTScan Details for Unigene SGN-U568704

Score 
766
Direction 
Forward
Predicted Peptide Sequence 
GKGRAIYHDLNAYRILFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYMRTGRVTSESVVYSFGTMLLDLLSGKHIPPSHALDXDPG
EEFIDVDGFLFGGDFSNDDGTELVRLATRCLQYEARERPNAKSLVNSLITIQKETEVPSHVLLGIRHGAATPPQPLVLTTMGEACLRRDL
TALHEILQKTGYKDDEGIANELSFQMWTNQMQETLNSKQQGDAAFRAKDFITAIECYTQFNDGGTMVSPTIYARRCLCYLMSDMAQEALR
DAMQAQVISSEWPTAFYLQSVALFTLGMENDAQEALKEAXKVGRQKEQKLKYX
Predicted Coding Sequence 
GGTAAGGGTCGAGCAATATATCATGATCTTAATGCTTACAGAATCTTGTTTGATCAGGATGGTAATCCTAGACTATCTTGCTTTGGCCTG
ATGAAGAACAGTAGAGATGGAAAAAGTTATAGTACAAACTTGGCATTCACACCTCCAGAGTACATGAGAACAGGAAGAGTGACATCTGAA
AGTGTAGTTTACAGCTTTGGAACAATGTTGCTAGATCTTTTGAGTGGAAAACATATACCTCCAAGCCATGCACTTGATXCTGATCCGGGT
GAAGAATTTATCGATGTTGATGGATTCTTGTTTGGAGGTGATTTTTCTAATGATGATGGAACCGAGCTAGTGCGGCTAGCCACCCGTTGT
TTACAGTATGAAGCACGTGAGAGGCCAAATGCAAAATCTCTTGTTAATTCTCTTATTACCATTCAGAAAGAAACAGAGGTACCATCACAT
GTTTTGCTGGGAATTAGACATGGAGCTGCAACCCCACCCCAACCATTGGTGTTGACAACAATGGGTGAAGCATGTCTGAGAAGAGATCTG
ACTGCCCTTCATGAGATATTGCAAAAGACGGGGTACAAGGATGATGAAGGAATTGCCAATGAGCTTTCTTTCCAAATGTGGACAAATCAG
ATGCAGGAAACCTTGAACTCTAAGCAACAAGGAGATGCTGCTTTCCGAGCCAAGGATTTCATAACAGCCATTGAATGCTACACACAGTTC
AATGATGGAGGGACCATGGTGTCACCCACCATATACGCGAGGCGCTGCTTGTGTTATCTGATGAGCGACATGGCACAAGAAGCTTTAAGA
GATGCAATGCAAGCTCAGGTTATATCCTCTGAGTGGCCTACCGCCTTTTATCTCCAGTCTGTTGCCCTTTTTACCCTTGGGATGGAGAAT
GATGCTCAAGAAGCACTAAAAGAAGCCAXCAAAGTTGGAAGGCAAAAAGAGCAAAAATTAAAATACTXX
Edits in Original Sequence 
(5')GGTAAGGGTCGAGCAATATATCATGATCTTAATGCTTACAGAATCTTGTTTGATCAGGATGGTAATCCTAGACTATCTTGCTTTGG
CCTGATGAAGAACAGTAGAGATGGAAAAAGTTATAGTACAAACTTGGCATTCACACCTCCAGAGTACATGAGAACAGGAAGAGTGACATC
TGAAAGTGTAGTTTACAGCTTTGGAACAATGTTGCTAGATCTTTTGAGTGGAAAACATATACCTCCAAGCCATGCACTTGATXCTGATCC
GGGTGAAGAATTTATCGATGTTGATGGATTCTTGTTTGGAgGGTGATTTTTCTAATGATGATGGAACCGAGCTAGTGCGGCTAGCCACCC
GTTGTTTACAGTATGAAGCACGTGAGAGGCCAAATGCAAAATCTCTTGTTAATTCTCTTATTACCATTCAGAAAGAAACAGAGGTACCAT
CACATGTTTTGCTGGGAATTAGACATGGAGCTGCAACCCCACCCCAACCATTGGTGTTGACAACAATGGGTGAAGCATGTCTGAGAAGAG
ATCTGACTGCCCTTCATGAGATATTGCAAAAGACGGGGTACAAGGATGATGAAGGAATTGCCAATGAGCTTTCTTTCCAAATGTGGACAA
ATCAGATGCAGGAAACCTTGAACTCTAAGCAACAAGGAGATGCTGCTTTCCGAGCCAAGGATTTCATAACAGCCATTGAATGCTACACAC
AGTTCAATGATGGAGGGACCATGGTGTCACCCACCATATACGCGAGGCGCTGCTTGTGTTATCTGATGAGCGACATGGCACAAGAAGCTT
TAAGAGATGCAATGCAAGCTCAGGTTATATCCTCTGAGTGGCCTACCGCCTTTTATCTCCAGTCTGTTGCCCTTTTTACCCTTGGGATGG
AGAATGATGCTCAAGAAGCACTAAAAGAAGCCAXCAAAGTTGGAAGGCAAAAAGAGCAAAAATTAAAATACTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan