ESTScan Details for Unigene SGN-U568768

Score 
925
Direction 
Forward
Predicted Peptide Sequence 
XKKKKSTEKTRKXQKSTAQLSVIQSKRLFFAFDSSDSSAAVENLLRLLIIAAAVSEFTGDCEEEKNFSSGELILHCLRLLHPMFPIIISQ
SVDLDGHFLIGATPEKPNNQFQLLMEQADNRSNDEHVIDITSSNDASSSSNPHDRPVNNVLHVQAEHPPSTSTTVPVSQHAFSSASRSNL
RNSSFAEEEVGAAIGXPLNSVLWISIELVLTLSQIIAAIAVLAISRDEHPRAPLAQWIVGYASGCVAILPLLYWRFRHRNQNSDQDSSQQ
PQISSQVELSARPSSSTRSSEGEGRQTTATASTGGQSNEILSTRIKSFVEYFKMALDCFFAVWFVVGNVWIFGGHSSSSEAPNLYRLCIV
FLTFSCIGYAMPFILVQQYAAASPALFQSWASEKXLTQNKGATPESINALPTYKFKVKKNKSGNKEAAEGGVVAAGTDKERVISGEDAAC
CICLAKYVNNDELRELPCSHFFHKDCVDKWLKINNSCPLCKAEVGETLLSSLTEATASLLRVPRFKLRLCPHASXRDAF*
Predicted Coding Sequence 
XTAAAAAAGAAAAAATCTACAGAGAAAACGCGTAAAXCTCAGAAATCCACAGCTCAACTAAGTGTTATTCAATCCAAAAGACTTTTCTTT
GCTTTCGATTCATCTGATTCTTCAGCTGCAGTAGAAAACCTGCTTAGACTTCTCATTATAGCTGCTGCAGTCTCTGAATTTACTGGTGAT
TGTGAAGAGGAGAAGAATTTTTCATCTGGTGAACTCATACTTCACTGCTTAAGACTTTTGCATCCCATGTTTCCTATAATTATCTCTCAG
TCAGTGGACTTAGATGGCCATTTCCTCATTGGGGCTACACCGGAAAAGCCAAACAACCAGTTTCAATTATTAATGGAGCAAGCAGATAAC
CGTAGCAACGATGAGCATGTAATTGACATAACTAGTAGCAATGATGCATCCTCATCAAGCAACCCCCATGATAGACCAGTTAATAATGTG
CTTCATGTCCAAGCTGAACATCCCCCATCAACAAGCACAACAGTGCCCGTCTCCCAACATGCATTTTCTTCTGCTAGTAGATCCAACTTG
AGGAACTCATCATTTGCTGAAGAGGAAGTGGGCGCCGCCATCGGAGXTCCTCTGAATTCTGTGCTCTGGATATCCATTGAACTAGTCTTG
ACATTGAGCCAAATAATTGCAGCAATCGCGGTGTTGGCCATATCAAGGGATGAGCACCCACGAGCTCCTCTAGCCCAATGGATAGTTGGT
TATGCATCTGGGTGTGTAGCAATTCTCCCTCTTCTCTACTGGCGTTTTCGTCATAGAAACCAAAATTCAGATCAGGATTCATCTCAGCAG
CCACAGATTTCTTCCCAGGTTGAACTCTCAGCCAGACCATCCTCAAGTACAAGGAGTTCAGAAGGTGAAGGTCGTCAGACAACTGCTACA
GCTTCTACAGGTGGTCAAAGTAATGAAATACTGAGCACAAGGATAAAATCATTTGTTGAGTACTTCAAAATGGCATTAGATTGTTTTTTT
GCAGTGTGGTTTGTGGTTGGAAATGTGTGGATATTTGGCGGACACTCCTCTTCCTCTGAGGCTCCCAACTTGTACAGGTTGTGTATAGTA
TTTCTGACCTTTAGCTGTATCGGGTATGCCATGCCATTTATTCTTGTGCAACAATATGCTGCTGCCTCCCCTGCATTATTTCAGTCATGG
GCTTCCGAGAAGATXCTGACTCAAAACAAAGGCGCCACACCAGAATCAATTAATGCTCTTCCGACCTATAAATTTAAGGTAAAGAAAAAC
AAAAGTGGCAACAAAGAGGCTGCTGAAGGTGGGGTTGTGGCTGCAGGAACGGACAAGGAGCGTGTGATTTCAGGAGAAGATGCGGCATGT
TGCATTTGCTTAGCAAAGTATGTGAACAATGATGAGCTAAGGGAGTTACCCTGTTCTCATTTCTTCCACAAGGACTGTGTTGATAAGTGG
CTGAAAATCAACAACTCATGTCCCCTTTGCAAAGCTGAGGTGGGTGAGACCCTTTTGAGCTCTCTAACGGAAGCAACTGCAAGTTTGCTC
AGAGTTCCGCGTTTTAAGTTACGACTCTGCCCACATGCTAGTXATAGAGATGCTTTTTAA
Edits in Original Sequence 
(5')XTAAAAAAGAAAAAATCTACAGAGAAAACGCGTAAAXCTCAGAAATCCACAGCTCAACTAAGTGTTATTCAATCCAAAAGACTTTT
CTTTGCTTTCGATTCATCTGATTCTTCAGCTGCAGTAGAAAACCTGCTTAGACTTCTCATaTATAGCTGCTGCAGTCTCTGAATTTACTg
GGTGATTGTGAAGAGGAGAAGAATTTTTCATCTGGTGAACTCATACTTCACTGCTTAAGACTTTTGCATCCCATGTTTCCTATAATTATC
TCTCAGTCAGTGGACTTAGATGGCCATTTCCTCATTGGGGCTACACCGGAAAAGCCAAACtAACCAGTTTCAATTATTAATGGAGCAAGC
AGATAACCGTAGCAACGATGAGCATGTAATTGACATAACTAGTAGCAATGATGCATCCTCATCAAGCAACCCCCATGATAGACCAGTTAA
TAATGTGCTTCATGTCCAAGCTGAACATCCCCCATCAACAAGCACAACAGTGCCCGTCTCCCAACATGCATTTTCTTCTGCTAGTAGATC
CAACTTGAGGAACTCATCATTTGCTcGAAGAGGAAGTGGGCGCCGCCATCGGAGXTCCTCTGAATTCTGTGCTCTGGATATCCATTGAAC
TAGTCTTGACATTGAGCCAAATAATTGCAGCAATCGCGGTGTTGGCCATATCAAGGGATGAGCACCCACGAGCTCCTCTAGCCCAATGGA
TAGTTGGTTATGCATCTGGGTGTGTAGCAATTCTCCCTCTTCTCTACTGGCGTTTTCGTCATAGAAACCAAAATTCAGATCAGGATTCAT
CTCAGCAGCCACAGATTTCTTCCCAGGTTGAACTCTCAGCCAGACCATCCTCAAGTACAAGGAGTTCAGAAGGTGAAGGTCGTCAGACAA
CTGCTACAGCTTCTACAGGTGGTCAAAGTAATGAAATACTGAGCACAAGGATAAAATCATTTGTTGAGTACTTCAAAATGGCATTAGATT
GTTTTTTTGCAGTGTGGTTTGTGGTTGGAAATGTGTGGATATTTGGCGGACACTCCTCTTCCTCTGAGGCTCCCAACTTGTACAGGTTGT
GTATAGTATTTCTGACCTTTAGCTGTATCGGGTATGCCATGCCATTTATTCTaTGTGCAACAATATGCTGCTGCCTCCCCTGCATTATTT
CAGTCATGGGCTTCCGAGAAGATXCTGACTCAAAACAAAGGCGCCACACCAGAATCAATTAATGCTCTTCCGACCTATAAATTTAAGGTA
AAGAAAAACAAAAGTGGCAACAAAGAGGCTGCTGAAGGTGGGGTTGTGGCTGCAGGAACGGACAAGGAGCGTGTGATTTCAGGAGAAGAT
GCGGCATGTTGCATTTGCTTAGCAAAGTATGTGAACAATGATGAGCTAAGGGAGTTACCCTGTTCTCATTTCTTCCACAAGGACTGTGTT
GATAAGTGGCTGAAAATCAACAACTCATGTCCCCTTTGCAAAGCTGAGGTGGGTGAGACCCTTTTGAGCTCTCTAACGGAAGCAACTGCA
AGTTTGCgTCAGAGTTCCGCGTTTTAAGTTACGACTCTGCCCACATGCTAGTXATAGAGATGCTTTTTAA(3')AGGAATAGTAGTTACC
TTCATATATATTTTATTTTCTTCCATCACTCTTCTGATTTTCTTTTTGGCTAATGTTGTTAGCTTGCTAGATTTATATACAATTTCTGTT
GCAAACATGTCATGTGAAGTGATAAGATTGCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan