ESTScan Details for Unigene SGN-U568979

Score 
569
Direction 
Forward
Predicted Peptide Sequence 
MGLRLGLIFVDKVRVFKPKQVESVWNHNWXLIEKSFNVKYSDGVREALDELPDSFTITDPSISGHPIVYVSRGFLKVFGYSKNEVLGKNG
RVFQGPKTNRRSVMAIREAIREERGIQISLLNYRKDGTPFWMLFNMCPVYSEKDGEGGSFFGNSSAYFEEEKFTXVVELGEMEEYVMMEV
IAGGMSISVVGGRFARIXMMEMDRALSVDSVSGLDHTEVDVEGPCEASDQEKTKASVAVNNIMSVLANYSELNGDWSLTGDAVNRERXLL
SASLNISFGRIKQSFVLTDAHLPDMPIVYASDAFLKLIGYLRHEVLGRNCRFLSGEDTERGTQFQIKQCIQNEQPCTVHILNYRKDGTSF
WNFLHISPIRSASGKVAYFVGIQIEDTTEAREKQGLNPEMRHRSVVAAVKVAVKGGQWVQVPPSS*
Predicted Coding Sequence 
ATGGGATTGAGATTGGGGTTAATCTTTGTTGATAAAGTTAGAGTCTTTAAGCCAAAACAAGTTGAATCAGTATGGAATCACAACTGGGXT
TTAATTGAAAAATCATTTAATGTTAAATACTCAGATGGGGTTAGAGAAGCTCTTGATGAATTGCCTGATAGTTTTACAATTACTGATCCC
TCTATTTCTGGTCACCCTATTGTTTATGTATCAAGGGGTTTCTTGAAAGTATTTGGTTATTCAAAGAATGAGGTTTTAGGGAAGAATGGA
AGGGTATTTCAAGGGCCTAAGACTAATAGAAGATCAGTTATGGCGATTCGAGAGGCGATTCGTGAGGAGAGGGGTATACAGATTAGTTTG
TTGAATTATAGGAAGGATGGGACACCCTTTTGGATGTTGTTTAATATGTGTCCTGTTTATAGTGAGAAGGATGGXGAGGGTGGTTCATTT
TTTGGGAATTCAAGTGCCTATTTTGAGGAGGAGAAATTCACTAXGGTGGTGGAATTGGGAGAAATGGAGGAGTATGTTATGATGGAGGTA
ATTGCAGGGGGTATGTCTATAAGTGTTGTAGGAGGGAGGTTTGCTCGAATTCXGATGATGGAAATGGACAGAGCGTTATCGGTTGATTCA
GTTTCGGGGTTGGACCATACAGAAGTAGATGTTGAAGGACCTTGTGAAGCAAGTGATCAAGAGAAGACAAAAGCCAGTGTTGCTGTCAAC
AACATAATGTCCGTGTTGGCAAACTACAGTGAGTTGAATGGAGACTGGTCATTGACAGGAGATGCTGTCAATCGGGAACGAGXTCTGCTC
AGTGCATCCTTAAATATATCTTTTGGTAGAATAAAACAAAGCTTTGTATTAACTGACGCACACTTACCAGACATGCCAATTGTCTATGCA
AGTGATGCCTTCCTAAAATTAATAGGCTACTTGAGACATGAAGTATTGGGTCGTAATTGCCGGTTTTTAAGTGGGGAAGATACAGAGAGA
GGCACACAATTTCAGATAAAACAATGCATCCAAAATGAACAACCGTGTACTGTACATATCTTAAATTACAGAAAAGATGGAACGTCATTT
TGGAATTTTCTTCACATCTCACCGATCCGAAGTGCTTCAGGAAAGGTCGCGTATTTTGTTGGCATTCAGATAGAAGATACTACCGAGGCT
CGGGAGAAACAAGGACTGAATCCGGAAATGAGGCATCGCAGTGTTGTAGCTGCTGTAAAGGTGGCTGTGAAGGGTGGTCAATGGGTGCAA
GTACCTCCTAGTTCATGA
Edits in Original Sequence 
GGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGACATACCCCCAATTCTTATTGTTCATTCAATACCTTAC
AACTTAGATATTTTTCTCCATGTAAGCTCTTCAATATTGTTTTTATCGTAACTGATAAAATTATTGTTATATATGAGTCTTTTTTAGAAA
TATAAAATAAGATTGTGTTAGATTTGTTATATAGCGTGAAATGAATTAATGAGTTTCGTAAAAATGCAGGCAAGACTGTGTTAGATTTAG
AGTTTTAGTATATGGGGTTGTCTTTTCTTATGTGTGGTATGTTAAATTCTATGTGCTATTTCTATGGTTATTTTTTTGTTTATTGATGAT
TTGTTTGTTCTTGTTTTGTGTATGGTTTGAAGCTGAAGTTCCCAATTATACTAGTTGACAC
(5')ATGGGATTGAGATTGGGGTTAATCT
TTGTTGATAAAGTTAGAGTCTTTAAGCCAAAACAAGTTGAATCAGTATGGAATCACAACTGGGXTTTAATTGAAAAATCATTTAATGTTA
AATACTCAGATGGGGTTAGAGAAGCTCTTGATGAATTGCCTGATAGTTTTACAATTACTGATCCCTCTATTTCTGGTCACCCTATTGTTT
ATGTATCAAGGGGTTTCTTGAAAGTATTTGGTTATTCAAAGAATGAGGTTTTAGGGAAGAATGGAAGGGTATTTCAAGGGCCTAAGACTA
ATAGAAGATCAGTTATGGCGATTCGAGAGGCGATTCGTGAGGAGAGGGGTATACAGATTAGTTTGTTGAATTATAGGAAGGATGGGACAC
CCTTTTGGATGTTGTTTAATATGTGTCCTGTTTATAGTGAGAAGGATGGXGAGGGTGGTTCATTTTTTGGGAATTCAAGTGCCTATTTTG
AGGAGGAGAAATTCACTAXGGTGGTGGAATTGGGAGAAATGGAGGAGTATGTTATGATGGAGGTAATTGCAGGGGGTATGTCTATAAGTG
TTGTAGGAGGGAGGTTTGCTCGAATTCXGATGATGGAAATGGACAGAGCGTTATCGGTTGATTCAGTTTCGGGGTTGGACCATACAGAAG
TAGATGTTGAAGGACCTTGTGAAGCAAGTGATCAAGAGAAGACAAAAGCCAGTGTTGCTGTCAACAACATAATGTCCGTGTTGGCAAACT
ACAGTGAGTTGAATGGcAGACTGGTCATTGACAGGAGATGCTGTCAATCGGGAACGAGXTCTGCTCAGTGCATCCTTAAATATATCTTTT
GGTAGAATAAAACAAAGCTTTGTATTAACTGACGCACACTTACCAGACATGCCAATTGTCTATGCAAGTGATGCCTTCCTAAAATTAATA
GGCTACTTGAGACATGAAGTATTGGGTCGTAATTGCCGGTTTTTAAGTGGGGAAGATACAGAGAGAGGCACACAATTTCAGATAAAACAA
TGCATCCAAAATGAACAACCGTGTACTGTACATATCTTAAATTACAGAAAAGATGGAACGTCATTTTGGAATTTTCTTCACATCTCACCG
ATCCGAAGTGCTTCAGGAAAGGTCGCGTATTTTGTTGGCATTCAGATAGAAGATACTACCGAGGCTCGGGAGAAACAAGGACTGAATCCG
GAAATGAGGCATCGCAGTGTTGTAGCTGCTGTAAAGGTGGCTGTGAgAGGGTGGTCAATGGGTGCAAGTACCTCCTAGTTCATGA(3')A
GAAATTTGTGTTTTGCCTTTTTTGGTTCTGATAAACAAACTGGACTCTGCTGAAAAAAATGTACTCTTGTTAGCTCATTGGTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan