ESTScan Details for Unigene SGN-U569083

Score 
117
Direction 
Reverse
Predicted Peptide Sequence 
XPRLDGKISRSAQKLSIVANRCLVRHAKTRPKMSEVLEMVNKVVETSTGIGNPGPPVRIAEPTSPESTRKGKRKVDTKLGDGSRLVRIWS
TKLTNTC*
Predicted Coding Sequence 
XXCCCAAGGCTTGATGGTAAGATCTCAAGGTCAGCTCAGAAGCTCTCTATAGTCGCCAACCGCTGCTTAGTCAGACATGCAAAGACACGT
CCAAAAATGAGCGAAGTCCTGGAAATGGTGAACAAAGTTGTCGAGACATCAACAGGAATAGGAAACCCTGGACCACCTGTGAGAATCGCG
GAACCAACTTCACCAGAATCTACAAGGAAAGGTAAGAGGAAGGTAGACACCAAACTCGGAGATGGTAGCCGGTTAGTACGTATATGGTCA
ACAAAGCTTACAAACACTTGTTAA
Edits in Original Sequence 
(5')XXCCCAAGGCTTGATGGTAAGATCTCAAGGTCAGCTCAGAAGCTCTCTATAGTCGCCAACCGCTGCTTAGTCAGACATGCAAAGAC
ACGTCCAAAAATGAGCGAAGTCCTGGAAATGGTGAACAAAGTTGTCGAGACATCAACAGGAATAGGAAACCCTGGACCACCTGTGAGAAT
CGCGGAACCAACTTCACCAGAATCTACAAGGAAAGGTAAGAGGAAGGTAGACACCAAACTCGGAGATGGTAGCCGGTTAGTACGTATATG
GTCAACAAAGCTTACAAACACTTGTTAA(3')TACAATAGTTTCCAATATGCACAAAGAGAAAACAGAGTTGAAAAGGTAATGAAGAAGC
ACAGATTATATAACTAGTTCCCAATATGAATGAGGTCTTCTCCATTATTGTCTTATATTTATATATAATATAGATGTTTAAATTTATAGA
GAAAATCGTAATCATTCAAATGTACATTCAAATTTAGACGTGTTTAACAAATGAGGCATAAGTGTTGCTATTTGTATGAAGTTAAGCAGT
ATTGTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan