ESTScan Details for Unigene SGN-U569188

Score 
799
Direction 
Forward
Predicted Peptide Sequence 
QQRRMDFASVLSQKPVNNFHFPQNLRELTSRFVCRIEYGSFAIPRRMCFSNSLGSYYWKKRKKYKHILVKASRKESPYEVLGVSSSATAD
EIKKAYRKLALKYHPDVNKEQNAQEKFMRIKHAYNTLLNSKTRKRYDSRSDTSSYSYYSGAEQNRSAADEEDFYSFADFFKDLQEEFRNW
EANVASTGKPKSLWEELAEIGEEFVEFLEKELNITDADVEDENNKERPQKGNAQSGTSNEKQMRTDKDNSIEENIDEIEAALAQLKKELD
YDGIESILAKKSNEILNIFLVVPGCKKKGSPTXKHVPTENQKAFAFFSLNTAVTDIFYSSQGELSAASFDV*
Predicted Coding Sequence 
CAGCAAAGGCGTATGGATTTTGCATCTGTTCTATCTCAAAAGCCAGTTAACAATTTTCATTTTCCTCAAAACCTAAGAGAGTTAACTTCA
AGATTTGTTTGCAGAATTGAGTATGGAAGCTTTGCGATACCTAGACGAATGTGCTTCTCGAATAGTCTAGGTAGCTATTATTGGAAGAAG
AGGAAAAAATACAAACATATATTGGTTAAGGCAAGTCGAAAAGAGTCTCCGTATGAAGTTTTAGGGGTATCTTCATCAGCGACCGCCGAT
GAAATCAAAAAGGCATATCGCAAACTTGCTCTCAAGTATCATCCCGATGTTAACAAAGAGCAAAATGCTCAAGAAAAATTTATGAGGATT
AAGCATGCATACAACACACTATTGAACTCCAAAACCAGGAAGCGATATGATTCAAGAAGTGACACCTCAAGTTATTCATATTATAGTGGA
GCAGAACAAAATAGAAGTGCTGCAGATGAAGAAGACTTTTATAGCTTTGCGGACTTCTTTAAGGATCTCCAAGAAGAATTTCGGAATTGG
GAGGCAAATGTTGCTTCCACCGGAAAACCAAAGAGTTTATGGGAAGAATTAGCTGAAATTGGAGAAGAATTTGTTGAGTTTTTAGAGAAG
GAGCTGAATATAACTGATGCAGATGTAGAAGACGAAAACAACAAGGAGAGACCCCAGAAGGGCAATGCACAATCTGGAACTAGTAACGAA
AAACAAATGAGAACAGATAAAGATAACAGTATAGAAGAAAATATTGATGAGATTGAAGCAGCTCTTGCCCAATTGAAAAAGGAATTGGAC
TATGATGGCATTGAATCGATACTCGCAAAGAAGAGCAATGAAATATTGAACATCTTTTTGGTTGTGCCTGGCTGCAAAAAAAAAGGTTCA
CCTACTXTTAAACATGTACCAACTGAAAATCAAAAAGCGTTTGCTTTCTTTTCCTTGAACACTGCTGTGACTGACATTTTCTATAGTAGC
CAAGGAGAACTGTCTGCTGCATCTTTTGACGTCTAA
Edits in Original Sequence 
(5')CAGCAAAGGCGTATGGATTTTGCATCTGTTCTATCTCAAAAGCCAGTTAACAATTTTCATTTTCCTCAAAACCTAAGAGAGTTAAC
TTCAAGATTTGTTTGCAGAATTGAGTATGGAAGCTTTGCGATACCTAGACGAATGTGCTTCTCGAATAGTCTAGGTAGCTATTATTGGAA
GAAGAGGAAAAAATACAAACATATATTGGTTAAGGCAAGTCGAAAAGAGTCTCCGTATGAAGTTTTAGGGGTATCTTCATCAGCGACCGC
CGATGAAATCAAAAAGGCATATCGCAAACTTGCTCTCAAGTATCATCCCGATGTTAACAAAGAGCAAAATGCTCAAGAAAAATTTATGAG
GATTAAGCATGCATACAACACACTATTGAACTCCAAAACCAGGAAGCGATATGATTCAAGAAGTGACACCTCAAGTTATTCATATTATAG
TGGAGCAGAACAAAATAGAAGTGCTGCAGATGAAGAAGACTTTTATAGCTTTGCGGACTTCTTTAAGGATCTCCAAGAAGAATTTCGGAA
TTGGGAGGCAAATGTTGCTTCCACCGGAAAACCAAAGAGTTTATGGGAAGAATTAGCTGAAATTGGAGAAGAATTTGTTGAGTTTTTAGA
GAAGGAGCTGAATATAACTGATGCAGATGTAGAAGACGAAAACAACAAGGAGAGACCCCAGAAGGGCAATGCACAATCTGGAACTAGTAA
CGAAAAACAAATGAGAACAGATAAAGATAACAGTATAGAAGAAAATATTGATGAGATTGAAGCAGCTCTTGCCCAATTGAAAAAGGAATT
aGGACTATGATGGCATTGAATCGATACTCGCAAAGAAGAGCAATGAAATATTGAACATCTTTTTGGTTGTGCCTGGCTGCAAAAAAAAAG
GTTCACCTACTXTTAAACATGTACCAACTGAAAATCAAAAAGCGTTTGCTTTCTTTTCCTTGAACAcCTGCTGTGACTGACATTTTCTAT
AGTAGCCAAGGAGAACTGTCTGCTGCATCTTTTGACGTCTAA(3')GAAATAGCTAGTATAATTGATGCTCAGACGAATACAATGATTTT
GGTGTTTCATGTGAGGTTTAATAGCAAACAGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan