ESTScan Details for Unigene SGN-U569224

Score 
430
Direction 
Forward
Predicted Peptide Sequence 
QARSFKVGRIVHARKFFAEMLSAGFIPDFYTHGIVINGYFKNGLVEEALSLFNKLEGNREINDIEFYNVVINGLCKTGKLDEARAIFEKL
YLIGLLPNARTYNKITNGFCLEGLLDEANDMLRKMEENGILPNFFTYNALVRGFLRCSKITEMTTFMKEMTGRGFSFDATTTELLLEVLR
ESPSVLDMILDLHSKIMK*
Predicted Coding Sequence 
CAGGCAAGGTCTTTTAAAGTTGGAAGAATAGTCCATGCGAGAAAATTCTTTGCTGAGATGCTATCTGCAGGGTTCATACCTGATTTTTAC
ACTCATGGCATTGTGATCAATGGTTATTTTAAGAATGGACTTGTTGAAGAGGCTTTGTCGCTCTTTAATAAGTTGGAAGGAAACAGAGAA
ATTAATGATATTGAATTTTACAATGTTGTCATCAATGGATTGTGCAAAACTGGTAAACTCGATGAAGCTCGTGCTATTTTTGAGAAGCTT
TATTTAATTGGATTGCTTCCGAATGCGAGAACATACAATAAGATCACTAATGGATTTTGTCTTGAAGGGTTGTTAGATGAAGCTAATGAT
ATGCTTAGAAAAATGGAGGAGAATGGTATTTTGCCAAACTTCTTCACTTACAATGCCCTTGTGCGGGGATTTCTCAGGTGTAGCAAAATT
ACTGAAATGACAACTTTTATGAAGGAAATGACGGGTAGGGGGTTCTCATTTGATGCAACTACAACGGAGTTATTGTTAGAAGTTCTAAGG
GAGAGTCCGTCCGTCCTTGACATGATACTAGATCTTCACTCAAAAATTATGAAGTGA
Edits in Original Sequence 
(5')CAGGCAAGGTCTTTTAAAGTTGGAAGAATAGTCCATGCGAGAAAATTCTTTGCTGAGATGCTATCTGCAGGGTTCATACCTGATTT
TTACACTCATGGCATTGTGATCAATGGTTATTTTAAGAATGGACTTGTTGAAGAGGCTTTGTCGCTCTTTAATAAGTTGGAAGGAAACAG
AGAAATTAATGATATTGAATTTTACAATGTTGTCATCAATGGATTGTGCAAAACTGGTAAACTCGATGAAGCTCGTGCTATTTTTGAGAA
GCTTTATTTAATTGGATTGCTTCCGAATGCGAGAACATACAATAAGATCACTAATGGATTTTGTCTTGAAGGGTTGTTAGATGAAGCTAA
TGATATGCTTAGAAAAATGGAGGAGAATGGTATTTTGCCAAACTTCTTCACTTACAATGCCCTTGTGCGGGGATTTCTCAGGTGTAGCAA
AATTACTGAAATGACAACTTTTATGAAGGAAATGACGGGTAGGGGGTTCTCATTTGATGCAACTACAACGGAGTTATTGTTAGAAGTTCT
AAGGGAGAGTCCGTCCGTCCTTGACATGATACTAGATCTTCACTCAAAAATTATGAAGTGA(3')ATATTCTTTTGACCTGATTTATTCG
GCTACACTATCATTGTGATACAATTTCCTTTTAACCACTGCAAAAGAAATGCTTTCTAATGCAGTCGTGGAAGCAGAAAAGCTAATTAGA
AC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan