ESTScan Details for Unigene SGN-U569264

Score 
166
Direction 
Forward
Predicted Peptide Sequence 
SGSFLTRFQTRHVSAITDSSKYRSDNQDXATMFFDNFIADSEKQPGRDLTKNVSIYIIGKRNYYYEFSAFEVGFWAFVAQNPKCLAMLAS
KVAMLLAKRMKMNQTKQIHAAILVNGLFDLESLLVQQIINSASSCTYYTSHYIKLVLSHLQNLDVFSVASTIRFYSRHCQFREAVNLYGE
LQRCGLSPSTFAVSSALKACARILYRSGGISIHAQVFKYGFCNVVYVRTALVDFYSKVGNMDFARSIFDDEMVEKNIVSWNSVLGGYVKS
GDLTMAQSVFDEMPEKDVISWNSMVSGYARMGNIERANALFRQMPERSSASWNAMISGYIECGKIEFARSFFEAMDKKNNVSYSYRFLDT
QKMEX
Predicted Coding Sequence 
TCCGGGTCGTTTTTGACCCGATTTCAGACCCGTCATGTTTCCGCCATTACAGACAGCTCCAAATACAGATCTGATAATCAAGATXCTGCA
ACAATGTTTTTTGACAATTTTATTGCAGATTCCGAGAAGCAACCAGGCAGAGATTTAACTAAAAATGTAAGTATTTACATTATTGGAAAA
CGAAATTATTACTATGAATTTTCTGCTTTCGAAGTTGGATTTTGGGCATTTGTTGCCCAAAACCCTAAATGTTTAGCGATGTTGGCGTCT
AAAGTTGCTATGTTGTTGGCTAAGCGTATGAAAATGAATCAAACAAAGCAAATACATGCTGCAATACTTGTGAATGGTCTTTTTGATCTT
GAGTCCTTGCTAGTTCAGCAGATAATCAACTCTGCAAGTAGTTGCACTTATTATACCTCACACTATATTAAACTAGTCCTCAGTCATTTG
CAAAATTTAGATGTGTTCTCGGTGGCGTCTACCATTCGATTCTATTCTAGGCATTGTCAGTTCAGGGAGGCTGTTAATTTATATGGAGAA
CTGCAGAGATGTGGACTTAGTCCGAGTACATTTGCTGTATCGTCTGCTTTAAAGGCTTGTGCAAGGATTTTGTATAGGTCTGGTGGGATA
TCGATTCATGCACAAGTTTTTAAGTATGGCTTTTGTAATGTTGTTTATGTGCGGACAGCTCTAGTAGATTTTTACTCGAAAGTAGGTAAT
ATGGATTTTGCCCGGAGCATCTTTGATGATGAGATGGTTGAGAAAAATATTGTATCGTGGAATTCAGTGTTAGGTGGATATGTCAAATCT
GGTGACTTAACAATGGCACAAAGTGTTTTTGATGAGATGCCGGAGAAGGATGTTATTTCGTGGAACTCCATGGTGTCTGGGTATGCGAGG
ATGGGGAATATAGAGCGGGCAAATGCATTGTTTAGACAGATGCCGGAGAGAAGTTCTGCCTCTTGGAATGCAATGATTAGCGGATATATA
GAGTGTGGGAAGATAGAGTTTGCACGCAGTTTCTTTGAGGCAATGGACAAAAAGAATAATGTTTCATATTCATATAGATTTCTGGATACT
CAAAAAATGGAGATX
Edits in Original Sequence 
(5')TCCGGGTCGTTTTTGACCCGATTTCAGACCCGTCATGTTTCCGCCATTACAGACAGCTCCAAATACAGATCTGATAATCAAGATXC
TGCAACAATGTTTTTTGACAATTTTATTGCAGATTCCGAGAAGCAACCAGGCAGAGATTTAACTAAAAATGTAAGTATTTACATTATTcG
GAAAACGAAATTATTACTATGAATTTTCTGCTTTCGAAGTTGtGATTTTGGGCATTTGTTGCCCAAAACCCTAAATGTTTAGCGATGTTG
GCGTCTAAAGTTGCTATGTTGTTGGCTAAGCGTATGAAAATGAATCAAACAAAGCAAATACATGCTGCAATACTTGTGAATGGTCTTTTT
GATCTTGAGTCCTTGCTAGTTCAGCAGATAATCAACTCTGCAAGTAGTTGCACTTATTATACCTCACACTATATTAAACTAGTCCTCAGT
CATTTGCAAAATTTAGATGTGTTCTCGGTGGCGTCTACCATTCGATTCTATTCTAGGCATTGTCAGTTCAGGGAGGCTGTTAATTTATAT
GGAGAACTGCAGAGATGTGGACTTAGTCCGAGTACATTTGCTGTATCGTCTGCTTTAAAGGCTTGTGCAAGGATTTTGTATAGGTCTGGT
GGGATATCGATTCATGCACAAGTTTTTAAGTATGGCTTTTGTAATGTTGTTTATGTGCGGACAGCTCTAGTAGATTTTTACTCGAAAGTA
GGTAATATGGATTTTGCCCGGAGCATCTTTGATGATGAGATGGTTGAGAAAAATATTGTATCGTGGAATTCAGTGTTAGGTGGATATGTC
AAATCTGGTGACTTAACAATGGCACAAAGTGTTTTTGATGAGATGCCGGAGAAGGATGTTATTTCGTGGAACTCCATGGTGTCTGGGTAT
GCGAGGATGGGGAATATAGAGCGGGCAAATGCATTGTTTAGACAGATGCCGGAGAGAAGTTCTGCCTCTTGGAATGCAATGATTAGCGGA
TATATAGAGTGTGGGAAGATAGAGTTTGCACGCAGTTTCTTTGAGGCAATGGACAAAAAGAATAATGTTTCATATaTCATATAGATTTCT
GGATACTCAAAAAATGGAGATX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan