ESTScan Details for Unigene SGN-U569283

Score 
124
Direction 
Reverse
Predicted Peptide Sequence 
MAXLEFKAKPLVMAYQPTKSHNQKNRKNDKANSYRINEIVTKKKKSTLEIEIVXKMSVVVVDGPMMEEFVDDAEAFGKWTDKHFDMLDTD
GNGECLEGGP
Predicted Coding Sequence 
ATGGCTCAXCTAGAATTTAAGGCAAAACCTTTAGTTATGGCCTATCAACCAACAAAAAGCCACAACCAAAAGAATAGGAAGAATGACAAA
GCAAATTCTTATAGAATAAATGAAATAGTAACAAAGAAGAAGAAATCAACACTTGAAATTGAAATCGTCGAXAAAATGAGTGTAGTTGTT
GTTGATGGTCCAATGATGGAAGAATTCGTTGATGACGCTGAGGCGTTTGGCAAGTGGACGGACAAACATTTTGATATGCTAGACACAGAT
GGAAACGGGGAATGTCTCGAGGGGGGGCCC
Edits in Original Sequence 
GATTTCAGACAAACTCAATTTTGATGAAATTTGCTGATCGAAGCCCCCCCAAATGAACCGGCATCTCACCGGGGGAATGGATATTTGTTG
TTAATGCGTGGTGTATGATTATAGGGGTCTGGTCACGTTATTCTCTCTATCATCTCTTGTATGCACATTTTAGACTTATTAGGTTATAGT
TAGCTTTGTTTACTTGGGTACGGTACTCCCTTCAGATTGTGGCATATGAATTGCTTTACTCTCTCTACTTGTGCTCAATTGAAGATTCTC
GTAAAGACTTGAATGTGTTGAGGTTGAACCTTATTCAAATCATCTTTAATTTCGACTTTTACAATTTTGCCATAGCTGGTAGTTTTAGTA
GTTTAGTATTAAATATATTTTTCAAGAGTTGACTTTTGGATCAAAGCATGGTTGAAAAATAACCCACTTATTTTATGTTAAATCTTAGTG
GGAGACCCGTATAGAGTGGAAACTATTCTACTTTAATTCTTAAATCCATTATAATAATAATAATGAAAGATTGATAGGGCAAGAAAGTCC
CAC
(5')ATGGCTCAXCTAGAATTTAAGGCAAAACCTTTAGTTATGGCCTATCAACCAACAAAAAGCCACAACCAAAAGAATAGGAAGAA
TGACAAAGtCAAATTCTTATAGAATAAATGAAATAGTAACAAAGAgAGAAGAAATCAACACTTGAAATTGAAATCGTCGAXAAAATGAGT
GTAGTTGTTGTTGATGGTCCAATGATGGAAGAATTCGTTGATGACGCTGAGGCGTTTGGCAAGTGGACGGACAAACATTTTGATATGCTA
GACACAGATGGAAACGGGGAATGTCTCGAGGGGGGGCCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan