ESTScan Details for Unigene SGN-U569521

Score 
525
Direction 
Forward
Predicted Peptide Sequence 
APRKEEEGKIHNTPKLNXNVETPSLEYLSFSXLSIYLSLQTVVSSMKWEMEVYEIEAVLEKIWDLHDKLSDAIHSVSRAQFLNSVKSRSK
SDDFYGHRSNKRNDNNGDQVKHGYVFVKEFPVDEDESAVHEAKSLNAIRTALEHLEHQLEFFHTVQNQQRAERDAALARLEQSRIVLAMR
LAEHPGKKYKFIEEAKSLVGDVRNGSQFVSPENLYGPATSATGENLTTQIKKRSNALLNIFFSSFDFFRKSLRVDEVGGILGNAALVAIS
MLALMHLQQVGSKEKYLLDLPLGQDVDYSRNIRKISQPEGXIIQPKFGCVVSQGLTHKMVRIGEKEDIMLCPAKFY*
Predicted Coding Sequence 
GCCCCGAGAAAAGAAGAAGAGGGAAAAATCCATAATACACCAAAATTAAATAAXAATGTAGAAACCCCTAGCCTAGAATACCTCTCTTTC
TCTXCTCTTTCAATATACCTTTCCCTCCAGACTGTGGTTTCCTCCATGAAATGGGAAATGGAGGTGTATGAAATCGAAGCTGTTCTCGAG
AAAATATGGGATTTACATGATAAACTTAGCGATGCTATTCACTCTGTTTCTCGAGCTCAATTCCTCAATTCCGTCAAGTCTCGCTCTAAG
TCCGATGACTTTTACGGTCACCGTTCTAACAAGAGAAATGATAACAATGGAGATCAGGTAAAGCATGGTTACGTTTTCGTTAAGGAGTTT
CCTGTTGATGAGGATGAATCCGCTGTTCATGAGGCTAAGAGTCTCAATGCTATCCGGACCGCACTTGAACACCTTGAGCACCAGCTCGAG
TTCTTCCATACCGTACAAAATCAGCAACGTGCAGAAAGGGATGCTGCTCTTGCTCGCTTAGAGCAAAGCCGAATTGTACTTGCAATGCGA
TTGGCTGAACATCCAGGTAAGAAATACAAATTCATTGAAGAAGCTAAATCTTTGGTGGGAGATGTTCGTAATGGCAGTCAGTTTGTTTCT
CCTGAAAATCTGTATGGTCCTGCTACAAGCGCCACAGGTGAAAATTTAACGACGCAGATAAAAAAGAGATCAAATGCTCTACTCAATATA
TTCTTTTCTAGTTTTGATTTCTTTAGAAAGTCTCTTAGAGTGGATGAAGTGGGTGGAATTTTGGGGAATGCAGCGTTGGTTGCAATCAGC
ATGCTTGCACTGATGCATCTGCAGCAAGTTGGTAGCAAGGAAAAATACCTTTTGGACCTCCCGTTAGGACAAGACGTTGACTACAGCAGA
AATATTAGAAAAATCTCTCAGCCCGAGGGGXTCATCATCCAGCCTAAATTTGGATGTGTTGTCAGCCAGGGGCTAACACATAAAATGGTG
AGGATTGGGGAGAAAGAGGATATTATGTTGTGTCCAGCCAAATTTTACTGA
Edits in Original Sequence 
(5')GCCCCGAGAAAAGAAGAAGAGGGAAAAATCCATAATACACCAAAATTAAATAAXAATGTAGAAACCCCTAGCCTAGAATACCTCTC
TTTCTCTXCTCTTTCAATATACCTTTCCCTCCAGACTGTGGTTTCCTCCATGAAATGGGAAATGGAGGTGTATGAAATCGAAGCTGTTCT
CGAGAAAATATGGGATTTACATGATAAACTTAGCGATGCTATTCACTCTGTTTCTCGAGCTCAATTCCTCAATTCCGTCAAGTCTCGCTC
TAAGTCCGATGACTTTTACGGTCACCGTTCTAACAAGAGAAATGATAACAATGGAGATCAGGTAAAGCATGGTTACGTTTTCGTTAAGGA
GTTTCCTGTTGATGAGGATGAATCCGCTGTTCATGAGGCTAAGAGTCTCAATGCTATCCGGACCGCACTTGAACACCTTGAGCACCAGCT
CGAGTTCTTCCATACCGTACAAAATCAGCAACGTGCAGAAAGGGATGCTGCTCTTGCTCGCTTAGAGCAAAGCCGAATTGTACTTGCAAT
GCGATTGGCTGAACATCCAGGTAAGAAATACAAATTCATTGAAGAAGCTAAATCTTTGGTGGGAGATGTTCGTAATGGCAGTCAGTTTGT
TTCTCCTGAAAATCTGTATGGTCCTGCTACAAGCGCCACAGGTGAAAATTTAACGACGCAGATAAAAAAGAGATCAAATGCTCTACTCAA
TATATTCTTTTCTAGTTTTGATTTCTTTAGAAAGTCTCTTAGAGTGGATGAAGTGGGTGGAATTTTGGGGAATGCAGCGTTGGTTGCAAT
CAGCATGCTTGCACTGATGCATCTGCAGCAAGTTGGTAGCAAGGAAAAATACCTTTTGGACCTCCCGTTAGGACAAGACGTTGACTACAG
CAGAAATATTAGAAAAATCTCTCAGCCCGAGGGGXTCATCATCCAGCCTAAATTTGGATGTGTTGTCAGCCAGGGGCTAACACATAAAAT
GGTGAGGATTGGGGAGAAAGAGGATATTATGTTGTGTCCAGCCAAATTTTACTGA(3')GGTGGGAGAACCAAGTTTCTTATAGTAGACG
GTAGTAAAGAAGGGAACCATATTTTTGCTATCTATAAATGTTGTAAAGAGCTACATCTCCCTTTCTTTGGAACATGTGACAGATTTTATA
CTATAGTCTATGTGCATGTGTCAGTGTGAAGTTCAAAAAAATTTGATTACCTGTTGCCGATGACCAAGTCATTCTTCATCTAAAGGTAAT
ATGCAGAATGTTTTGTATTAGCATTTAGAAGATTATTTAATATGAACGGCAAGCGAACGCTGATTGTCAATCTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan