ESTScan Details for Unigene SGN-U569555

Score 
532
Direction 
Forward
Predicted Peptide Sequence 
MATMGMTGSIGGYGAASASLFRLRNSAKKKTRNGKNGFRVSCVCSSSAVADPYKTLKIQPGASESEVRKAFRQLALKYHPDVCRGNNCGV
QFHQINEAYDVVMSNLRGETRAELEMIEEYDDSNDESMRGMHEPDWDLWEEWMGWEGAGIRDYTSHVNPYXMNVKXNDLGMKTQECKIRP
SSXKSKMVRGPCTYSIGSRGGLIVYIFGFPLCLLFYQLYSHLSLINKTFIFLIIKHKTMFPFSCLVLYAIYNVHITEVLSKKRHLCKCFR
NSMHLTQNAEGTGTGNLFEVTLLIXLVEDEPAESLAFRPYQLSPGNLGEIVARASGHEVPGNTEEDANDGDATEYVLLLTAI*
Predicted Coding Sequence 
ATGGCTACGATGGGAATGACGGGAAGTATTGGGGGTTATGGAGCAGCTTCAGCGTCTCTGTTTCGATTGAGGAACTCAGCGAAGAAGAAG
ACTAGAAACGGTAAAAATGGATTTAGGGTTTCATGTGTTTGTTCATCTTCTGCTGTTGCCGATCCGTATAAGACCTTGAAGATTCAACCC
GGTGCATCTGAATCTGAAGTTAGGAAGGCGTTTAGACAGCTTGCTCTTAAGTATCACCCAGACGTATGCAGAGGAAACAATTGTGGTGTT
CAATTTCACCAAATCAACGAAGCTTACGATGTGGTGATGAGTAATTTGAGAGGTGAAACAAGAGCAGAGCTGGAGATGATTGAGGAATAT
GATGATAGTAATGATGAATCAATGAGAGGAATGCATGAACCAGATTGGGATTTATGGGAAGAGTGGATGGGATGGGAAGGTGCTGGCATT
CGTGACTATACATCACATGTTAATCCTTACATXATGAATGTTAAAXTTAATGACTTGGGGATGAAAACCCAAGAATGTAAGATCCGTCCA
TCTTCTTTXAAATCAAAGATGGTTAGAGGTCCATGTACATATTCAATAGGAAGTAGAGGAGGXCTCATTGTGTACATATTTGGATTCCCT
CTTTGTTTGCTCTTTTACCAATTGTATTCACATCTCTCATTGATAAATAAAACATTCATATTTCTTATTATAAAACACAAAACTATGTTT
CCTTTTTCGTGTTTGGTTTTGTATGCAATATATAATGTTCATATTACAGAAGTTTTGTCCAAAAAGAGGCATTTATGCAAGTGCTTCAGG
AACAGCATGCACCTAACACAAAACGCTGAAGGAACTGGAACTGGAAACTTGTTTGAAGTAACTCTTCTCATTXATTTAGTTGAGGATGAA
CCAGCCGAGAGCCTCGCATTCCGGCCTTATCAGCTTTCTCCAGGTAATCTTGGTGAGATTGTTGCTCGAGCCTCGGGTCATGAAGTACCA
GGGAACACCGAAGAGGACGCCAATGACGGCGATGCCACCGAATACGTGCTTCTTCTCACCGCTATATAA
Edits in Original Sequence 
ATTATATTCCTTTTTTTTTTAACGATTAAAACAATCTCATTCTCTTTTTGAATTTGTGAATAATTTAATCATTTTCGATTTTCATTGAAA
TTTGTGTGCA
(5')ATGGCTACGATGGGAATGACGGGAAGTATTGGGGGTTATGGAGCAGCTTCAGCGTCTCTGTTTCGATTGAGGAACT
CAGCGAAGAAGAAGACTAGAAACGGTAAAAATGGATTTAGGGTTTCATGTGTTTGTTCATCTTCTGCTGTTGCCGATCCGTATAAGACCT
TGAAGATTCAACCCGGTGCATCTGAATCTGAAGTTAGGAAGGCGTTTAGACAGCTTGCTCTTAAGTATCACCCAGACGTATGCAGAGGAA
ACAATTGTGGTGTTCAATTTCACCAAATCAACGAAGCTTACGATGTGGTGATGAGTAATTTGAGAGGTGAAACAAGAGCAGAGCTGGAGA
TGATTGAGGAATATGATGATAGTAATGATGAATCAATGAGAGGAATGCATGAACCAGATTGGGATTTATGGGAAGAGTGGATGGGATGGG
AAGGTGCTGGCATTCGTGACTATACATCACATGTTAATCCTTACATXATGAATGTTAAAXTTAATGACTTGGGGATGAAAACCCAAGAAT
GTAAGATCCGTCCATCTTCTTTXAAATCAAAGATGGTTAGAGGTCCATGTACATATTCAATAGGAAGTAGAGGAGGXCTCATTGTGTACA
TATTTGGATTCCCTCTTTGTTTGCTCTTTTACCAATTGTATTCACATCTCTCATTGATAAATAAAACATTCATATTTCTTATTATAAAAC
ACAAAACTATGTTTCCTTTTTCGTGTTTGGTTTTGTATGCAATATATAATGTTCATATTACAGAAGTTTTGTCCAAAAAGAGGCATTTAT
GCAAGTGCTTCAGGAACAGCATGCACCTAACACAAAACGCTGAAGGAACTGGAACTGGAAACTTGTTTGAAGTAACTCTTCTCATTXATT
TAGTTGAGGATGAACCAGCCGAGAGCCTCGCATTCCGcGCCTTATCAGCTTTCTCCAGGTAATCTTGGTGAGATTGTTGCtTCGAGCCTC
GGGTCATGAAGTACCAGGGAACACCGAAGAGGACGCCAATGACGGCGATGCCACCGAATACGTGCTTCTTCTCACCGCTATATAA(3')T
ACATGCTCCAATTTGGCCCTAAACCCTCCTCCTCCTGCTCCATTCATCTTCTTCGCTTCACTTGCCATATTCTTCTCCATTTGTTTCCCT
TTCTCCCTAAAACCCTTAAACCCTATCGATTTTGTATTGCCAGTACTTACCAATAAAAATAAAGAAAGAGGCTATTCATTTTGAGTCTTG
AGCAGAGCAGCTGAGTGGGCTTATCGTGCACCCCCTTCACTCACGGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan