ESTScan Details for Unigene SGN-U569621

Score 
743
Direction 
Forward
Predicted Peptide Sequence 
MRFLSLVGNSFGCSASGERLISAARDGDIQEAKALLDYNPRLVRYSTFGVRNSPLHYSAAQGHHEIVSLLLESGVDINLRNYRGQTALMQ
ACQYGHWEVVQILILFMANIHKADYLNGGTSLHLAALNGHSRCIRLLLADYIPSIPNFCNVMRKRSKNEDSIQEFDDFALHEVINRPADG
GITALHMAAAEWPCGKSATTLGFGGFGHQGYCGGWATIDLIGAGSTPLHYAACGGNAQCCQLLIARGASLNAENVNGWTSLMVARSWHRD
GAGGDFKYSSRKTTTSPSFTILMPPSYEYVKIARECGWRTIDSPTSTCLDPCVVCLERKCTVAAEGVFMSSARTVHCTCVPPVTPQSQPT
ALQVRFLALYVDTGIVSFIKLAGYDTNHQGSSTNESVVAFLFLTADGQEPTTLETPLCKPDLYCSRLSPLGSSFLSLSCQKFPALRFSPG
LCMGTPDTSPSLVPRTGEREHLTRCSRPSFRRSTSNVEARRWLCSFSHSEKLEAVSELGPYAYFNYXIYSEILQVFLFXFVLFLNIFGSH
LFKKNFCLYISFKSYPXKNVIENFINKKAIIGAEIVTQRYANILGLSFQDAVGMAFDISSGLKDAEAWSCNLIDWMNFFVFLNAWNLYSH
EVDRDSNKHGTTWLVNLILKKCILDKVRSMGAPESSPGCDLPHLVLLVTEPLAWHIMVIQCCARSLLPSGKRKKKGGPSEQCNIELCQEV
QDSIRCVCETIELVRDWLNKQMSKSDNDKLESILSSLKRDGELGPWKVYRVIETLTSSSTIDKGLGDVITGALQSWSPVDITRKIITSQR
TSLSNFLRICDSKIKSVKELKAXIIAGWGNI*
Predicted Coding Sequence 
ATGAGATTTTTGAGCCTTGTGGGAAATTCATTTGGATGCTCTGCGTCAGGCGAGCGGTTAATTTCTGCAGCTAGAGATGGAGATATCCAG
GAAGCTAAGGCTTTACTGGATTATAATCCCCGGCTAGTGAGGTATTCGACTTTTGGTGTTCGAAATTCACCCCTCCATTACTCTGCTGCC
CAAGGACATCATGAGATTGTTAGTCTCTTGCTTGAGTCTGGAGTTGACATCAATCTCAGAAACTACCGTGGACAGACTGCTTTGATGCAA
GCATGTCAGTATGGTCACTGGGAAGTCGTTCAGATTCTCATTCTTTTCATGGCCAATATTCATAAGGCTGATTATCTCAACGGGGGTACA
TCACTTCATTTAGCTGCTCTAAATGGACATTCTCGATGTATACGGCTTCTCCTTGCTGATTATATTCCCAGCATCCCTAATTTCTGCAAT
GTCATGAGAAAGAGATCAAAAAACGAAGACTCTATCCAAGAATTCGATGACTTTGCACTACATGAGGTGATCAATAGACCTGCTGATGGT
GGCATTACCGCCCTTCATATGGCAGCXGCTGAATGGCCATGTGGAAAGTCTGCAACTACTCTTGGATTTGGGGGCTTCGGTCACCAAGGT
TACTGTGGAGGATGGGCTACAATTGATTTGATAGGTGCAGGAAGTACACCACTTCATTATGCTGCATGTGGTGGGAATGCTCAGTGTTGC
CAGCTTTTAATTGCCAGGGGTGCCAGTCTGAATGCAGAAAATGTGAATGGGTGGACATCTTTGATGGTTGCTCGATCATGGCATAGAGAT
GGXGCTGGAGGAGATTTTAAGTACTCGTCCAGAAAAACAACCACGTCCCCTTCCTTCACCATTCTTATGCCTCCCTCTTATGAGTATGTG
AAGATTGCTAGAGAATGTGGATGGAGAACAATTGATTCCCCTACGTCAACTTGTTTAGACCCTTGTGTTGTTTGTCTAGAAAGGAAGTGT
ACAGTTGCTGCAGAAGGTGTTTTCATGAGTTCTGCACGCACTGTGCATTGTACCTGTGTTCCACCAGTAACACCTCAATCGCAGCCCACG
GCCCTCCAGGTTCGATTCCTTGCCCTTTATGTCGACACXGGCATTGTTTCATTTATTAAGCTAGCXGGATACGACACCAATCATCAAGGA
AGCAGCACGAACGAGTCTGTCGTTGCCTTTTTGTTCCTTACAGCTGATGGACAAGAACCAACTACATTAGAAACACCTTTATGCAAGCCC
GATTTATATTGCTCCCGACTCTCCCCTCTAGGCTCTTCCTTCCTCTCGTTAAGCTGCCAAAAGTTCCCAGCATTGAGATTCAGCCCAGGC
CTTTGTATGGGAACGCCAGACACGAGTCCATCCTTAGTTCCGAGAACCGGTGAACGAGAACATCTGACTCGATGCTCACGACCTAGCTTT
AGGCGATCAACGTCAAACGTCGAAGCTAGAAGATGGTTGTGTTCCTTCAGCCATTCTGAGAAACTGGAAGCAGTTTCTGAATTAGGTCCC
TATGCCTATTTCAACTATXTAATTTACAGTGAAATCCTACAGGTTTTCCTCTTTXATTTTGTTCTTTTTTTAAATATTTTTGGTTCCCAT
TTATTCAAAAAGAACTTTTGTTTGTATATCTCTTTTAAGTCTTATCCAXCTAAAAATGTAATTGAAAATTTCATCAATAAAAAAGCTATC
ATCGGAGCTGAGATTGTTACTCAGCGGTATGCCAATATCTTGGGATTATCCTTCCAGGATGCTGTAGGGATGGCTTTTGATATTTCGAGT
GGTCTTAAGGATGCAGAGGCATGGAGCTGCAATCTGATTGATTGGATGAACTTTTTTGTATTTTTAAATGCTTGGAATCTTTATTCTCAT
GAAGTAGATAGAGATTCAAATAAGCATGGTACTACATGGCTTGTGAATTTGATTCTGAAGAAGTGTATCCTGGATAAAGTGAGATCAATG
GGAGCACCAGAGTCATCACCCGGATGTGATCTTCCTCATTTGGTGCTATTGGTAACTGAACCTTTAGCTTGGCATATTATGGTGATTCAG
TGTTGTGCCAGGTCATTATTGCCTTCAGGAAAGAGAAAAAAGAAAGGTGGACCTTCGGAGCAGTGTAACATTGAGTTGTGTCAAGAAGTA
CAGGATTCAATCCGTTGTGTATGTGAGACTATAGAGCTGGTTAGAGATTGGCTAAATAAACAAATGAGCAAGTCAGACAATGACAAATTG
GAAAGTATACTTTCATCACTCAAAAGAGATGGAGAGTTAGGACCCTGGAAGGTCTACCGCGTTATTGAAACTTTAACCTCGTCTTCAACA
ATTGATAAAGGTCTTGGTGATGTGATCACTGGAGCATTGCAGTCTTGGAGTCCTGTTGATATTACTAGAAAAATCATTACTAGTCAGCGA
ACTTCTTTATCTAATTTCCTTAGAATTTGTGATTCAAAAATCAAATCAGTGAAGGAACTGAAAGCTXCAATTATAGCTGGCTGGGGAAAT
ATTTGA
Edits in Original Sequence 
GAGTTTTTAATTAAAGAAAAAAGAGAGATTCTTGGCAGATCATTGTCCTTCTTGGTATTTGTGAATAAAATTAAAAAAAAATTAATTTTT
CATTTACGTGAGGCTCTCAACTTTCCCAATTGGTTTTTGTCTCCCAAATTGTTGCAAATTCCTGGAAATTTTGAGAGTCTCTGTGGGTTT
TTTTTCTGGGAGATTATTTTTTCTTGTTTTCTGAGAAAATTTGGATGTGGGTATTTGCTAATCTTGATTTTTTGTGGGGTTCTTGAGGAT
TTAAAAAAAAAATGTTTTTTTAGTGAACCCCATCAAGGAAATTGAGGTTTTTTATCTTCCCATTTGGTTGTATTAGCATATTTTGTGTAT
TGGGGGTGGAAAGTTTCATTCTTTGATAAATTTTCCTGGAAATATTTGGTGATATTTGATATTTTTCTGGGAAAATTTGGTGGGGTTATT
GAGGAATCTTGAAATAGTTGGAGGATTTGTGACATTTACAATCAAGAAAAGGTGAAAAAGTGATCAAAGATTTGATTTTTATGGGTTTTT
CATAAGCTCAGAACGATATCCGAAAACT
(5')ATGAGATTTTTGAGCCTTGTGGGAAATTCATTTGGATGCTCTGCGTCAGGCGAGCGGT
TAATTTCTGCAGCTAGAGATGGAGATATCCAGGAAGCTAAGGCTTTACTGGATTATAATCCCCGGCTAGTGAGGTATTCGACTTTTGGTG
TTCGAAATTCACCCCTCCATTACTCTGCTGCCCAAGGACATCATGAGATTGTTAGTCTCTTGCTTGAGTCTGGAGTTGACATCAATCTCA
GAAACTACCGTGGACAGACTGCTTTGATGCAAGCATGTCAGTATGGTCACTGGGAAGTCGTTCAGATTCTCATTCTTTTCATGGCCAATA
TTCATAAGGCTGATTATCTCAACGGGGGTACATCACTTCATTTAGCTGCTCTAAATGGACATTCTCGATGTATACGGCTTCTCCTTGCTG
ATTATATTCCCAGCATCCCTAATTTCTGCAATGTCATGAGAAAGAGATCAAAAAACGAAGACTCTATCCAAGAATTCGATGACTTTGCAC
TACATGAGGTGATCAATAGACCTGCTGATGGTGGCATTACCGCCCTTCATATGGCAGCXGCTGAATGGCCATGTGGAAAGTCTGCAACTA
CTCTTGGATTTGGGGGCTTCGGTCACCAAGGTTACTGTGGAGGATGGGaCTACAATTGATTTGATAGGTGCAGGAAGTACACCACTTCAT
TATGCTGCATGTGGTGGGAATGCTCAGTGTTGCCAGCTTTTAATTGCCAGGGGTGCCAGTCTGAATGCAGAAAATGTGAATGGGTGGACA
TCTTTGATGGTTGCTCGATCATGGCATAGAGATGGXGCTGGAGGAGATTTTAAGTACTCGTCCAGAAAAACAACCACGTCCCCTTCCTTC
ACCATTCTTATGCCTCCCTCTTATGAGTATaGTGAAGATTGCTAGAGAATGTGGATGGAGAACAATTGATTCCCCTACGTCAACTTGTTT
AGACCCTTGTGTTGTTTGTCTAGAAAGGAAGTGTACAGTTGCTGCAGAAGGtTGTTTTCATGAGTTCTGCACGCACTGTGCATTGTACCT
GTGTTCCACCAGTAACACCTCAATCGCAGCCCACGGCCCTCCAGGTTCGATTCCTTGCCCTTTATGTCGACACXGGCATTGTTTCATTTA
TTAAGCTAGCXGGATACGACACCAATCATCAAGGAAGCAGCACGAACGAGTCTGTCGTTGCCTTTTTGTTCCTgTACAGCTGATGGACAA
GAACCAACTACATTAGAAACACCTTTATGCAAGCCCGATTTATATTGCTCCCGACTCTCCCCTCTAGGCTCTTCCTTCCTCTCGTTAAGC
TGCCAAAAGTTCCCAGCATTGAGATTCAGCCCAGGCCTTTGTATGGGAACGCCAGACACGAGTCCATCCTTAGTTCCGAGAACCGGTGAA
CGAGAACATCTGACTCGATGCTCACGACCTAGCTTTAGGCGATCAACGTCAAACGTCGAAGCTAGAAGATGGTTGTGTTCCTTCAGCCAT
TCTGtAGAAACTGGAAGCAGTTTCTGAATTAGGTCCCTATGCCTATTTCAACTATXTAATTTACAGTGAAATCCTACAGGTTTTCCTCTT
TXATTTTGTTCTTTTTTTAAATATTTTTGGTTCCCATTTATTCAAAAAGAACTTTTGTTTGTATATCTCTTTTAAGTCTTATCCAXCTAA
AAATGTAATTGAAAtATTTCATCAATAAAAtAAGCTATCATCGGAGCTGAGATTGTTACTCgAGCGGTATGCCAATATCTTGGGATTATC
CTTCCAGGATGCTGTAGGGATGGCTTTTGATATTTCGAGTGGTCTTAAGGATGCAGAGGCATGGAGCTGCAATCTGATTGATTGGATGAA
CTTTTTTGTATTTTTAAATGCTTGGAATCTTTATTCTCATGAAGTAGATAGAGATTCAAATAAGCATGGTACTACATGGCTTGTGAATTT
GATTCTGAAGAAGTGTATCCTGGATAAAGTGAGATCAATGGGAGCACCAGAGTCATCACCCGGATGTGATCTTCCTCATTTGGTGCTATT
GGTAACTGAACCTTTAGCTTGGCATATTATGGTGATTCAGTGTTGTGCCAGGTCATTATTGCCTTCAGGAAAGAGAAAAAAGAAAGGTGG
ACCTTCGGAGCAGTGTAACATTGAGTTGTGTCAAGAAGTACAGGATTCAATCCGTTGTGTATGTGAGACTATAGAGCTGGTTAGAGATTG
GCTAAATAAACAAATGAGCAAGTCAGACAATGACAAATTGGAAAGTATACTTTCATCACTCAAAAGAGATGGAGAGTTAGGACCCTGGAA
GGTCTACCGCGTTATTGAAACTTTAACCTCGTCTTCAACAATTGATAAAGGTCTTGGTGATGTGATCACTGGAGCATTGCAGTCTTGGAG
TCCTGTTGATATTACTAGAAAAATCATTACTAGTCAGCGAACTTCTTTATCTAATTTCCTTAGAATTTGTGATTCAAAAATCAAATCAGT
GAAGGAACTGAAAGCTXCAATTATAGCTGGCTGGGGAAATATTTGA(3')TTTTTTTGTGGAGGGGAGTTCCAAGTGATTTTCTTGTTTT
TAATTTCTAGCTATTGTCTTTCTATAGTAGACTCATCTAACGTTGCTCCAAATTTTCATTTCGTCTTTCAATTTTATGTACAATAAACAT
GAAATTCATTTCCCGAAGTATCTTATTTGTTTAGCCGAAAATGTAATGTTTGCTTTTTGTAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan