Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U569625

Score 
1105
Direction 
Forward
Predicted Peptide Sequence 
XLKKGISRQFSTELFRKSGKFSFKRQSSLDPRRNNLRFSFGRQSSLDPLRRSPSIENAERTVPENLDSTMQLLFMACKGDVKGVQDLLDE
GIDVNSIDLDGRTALHIAACEGHVEVAKLLLSRKANMNARDRWGSTAAADAKHYGNAEVYEMLKARGAKVPKVGKTPMAVANPREVPEYE
LNPLELQIRKSDGISKGSYQVAKWNGTKVSVKILDKDSYKDPESINAFKHELTLLEKVRHPNVVQFVGAVTQNIPMMIVSEYHPRGDLGS
YLQKKGTLSPSKALKYALDVARGMNYLHECKPDPIIHCNLNPKNILLDDGDHLKVAGFGLIKLSKISPDKAKLVQPEGFDRSSPYVAPEI
YKDEIFDRNADIYSFGILLYEMLEGTPPFNTKSPEETARLMCLEGQRPVFKSKSKYPPELRELIEECWDPEAFVRPTFSEVIVRMNKIFA
NSFRQGWLKDTFKLPXVVSVHEGVKKMDNNWGQWSLSAEDSCGASIDDKPNRQTCSHKIP*
Predicted Coding Sequence 
XGGTTAAAGAAAGGAATATCGAGGCAATTCTCAACAGAGTTGTTTAGGAAGAGTGGAAAATTCAGTTTCAAGAGGCAGAGTTCATTGGAT
CCAAGGAGGAACAATTTGCGGTTTAGTTTTGGGAGGCAATCATCGCTTGATCCGCTTCGAAGGAGCCCTTCGATAGAAAATGCTGAGAGA
ACTGTGCCAGAGAATCTTGATTCGACGATGCAGCTGTTATTCATGGCGTGTAAAGGGGACGTGAAGGGAGTTCAGGACTTGTTGGATGAA
GGTATTGATGTGAATAGCATTGATTTGGATGGAAGGACTGCTCTTCATATTGCTGCCTGTGAAGGTCACGTGGAAGTTGCCAAGCTATTG
TTGAGTAGGAAGGCTAATATGAATGCTCGTGATCGGTGGGGTAGTACGGCAGCAGCTGATGCCAAACATTATGGTAATGCTGAAGTTTAC
GAAATGTTGAAGGCCCGTGGAGCCAAAGTCCCGAAAGTCGGAAAGACGCCAATGGCTGTAGCAAATCCACGAGAAGTTCCAGAATATGAA
CTAAACCCTCTGGAGCTTCAAATCCGCAAAAGTGATGGAATCTCAAAGGGTTCATATCAAGTTGCCAAATGGAATGGAACGAAAGTTTCC
GTAAAAATACTTGACAAGGATAGCTATAAAGATCCTGAAAGCATAAATGCTTTCAAACATGAATTAACTTTGCTAGAAAAAGTGCGGCAT
CCAAATGTAGTTCAGTTTGTTGGAGCAGTTACACAAAATATACCAATGATGATAGTGTCAGAGTATCATCCAAGGGGTGATCTAGGTAGC
TATCTTCAGAAAAAAGGGACGTTATCTCCTTCTAAGGCGCTTAAATATGCTCTTGATGTTGCTAGGGGTATGAACTACCTTCACGAGTGC
AAACCAGACCCAATTATACATTGCAATCTAAATCCAAAAAATATTTTGCTTGACGATGGAGATCACCTGAAAGTTGCTGGATTTGGTCTT
ATTAAATTGTCAAAAATTTCACCTGACAAAGCAAAGTTGGTGCAGCCGGAGGGTTTTGACCGTTCAAGTCCCTATGTAGCACCTGAGATT
TATAAAGATGAAATATTTGACCGGAATGCGGACATATATTCATTTGGCATTTTACTCTATGAGATGCTGGAGGGAACACCACCTTTTAAT
ACCAAGTCTCCAGAAGAGACTGCCAGGTTGATGTGCTTAGAAGGCCAGAGACCAGTATTCAAATCGAAATCCAAATATCCTCCTGAGCTT
AGAGAGTTGATTGAAGAATGTTGGGATCCAGAAGCTTTTGTCCGGCCAACATTTTCTGAGGTCATTGTGCGGATGAATAAAATATTTGCT
AACTCCTTCAGACAAGGATGGTTGAAAGATACTTTTAAACTTCCTXTGGTTGTAAGTGTACATGAAGGTGTCAAGAAGATGGACAATAAT
TGGGGTCAATGGAGTTTATCAGCGGAAGATTCATGTGGAGCTTCAATTGATGATAAACCTAATAGGCAAACTTGTAGTCACAAGATTCCT
TGA
Edits in Original Sequence 
(5')XGGTTAAAGAAAGGAATATCGAGGCAATTCTCAACAGAGTTGTTTAGGAAGAGTGGAAAATTCAGTTTCAAGAGGCAGAGTTCATT
GGATCCAAGGAGGAACAATTTGCGGTTTAGTTTTGGGAGGCAATCATCGCTTGATCCGCTTCGAAGGAGCCCTTCGATAGAAAATGCTGA
GAGAACTGTGCCAGAGAATCTTGATTCGACGATGCAGCTGTTATTCATGGCGTGTAAAGGGGACGTGAAGGGAGTTCAGGACTTGTTGGA
TGAAGGTATTGATGTGAATAGCATTGATTTGGATGGAAGGACTGCTCTTCATATTGCTGCCTGTGAAGGTCACGTGGAAGTTGCCAAGCT
ATTGTTGAGTAGGAAGGCTAATATGAATGCTCGTGATCGGTGGGGTAGTACGGCAGCAGCTGATGCCAAACATTATGGTAATGCTGAAGT
TTACGAAATGTTGAAGGCCCGTGGAGCCAAAGTCCCGAAAGTCGGAAAGACGCCAATGGCTGTAGCAAATCCACGAGAAGTTCCAGAATA
TGAACTAAACCCTCTGGAGCTTCAAATCCGCAAAAGTGATGGAATCTCAAAGGGTTCATATCAAGTTGCCAAATGGAATGGAACGAAAGT
TTCCGTAAAAATACTTGACAAGGATAGCTATAAAGATCCTGAAAGCATAAATGCTTTCAAACATGAATTAACTTTGCTAGAAAAAGTGCG
GCATCCAAATGTAGTTCAGTTTGTTGGAGCAGTTACACAAAATATACCAATGATGATAGTGTCAGAGTATCATCCAAGGGGTGATCTAGG
TAGCTATCTTCAGAAAAAAGGGACGTaTATCTCCTTCTAAGGCGCTTAAATATGCTCTTGATGTTGCTAGGGGTATGAACTACCTTCACG
AGTGCAAACCAGACCCAATTATACATTGCAATCTAAATCCAAAAAATATTTTGCTTGACGATGGAGATCACCTGAAAGTTGCTGGATTTG
GTCTTATTAAATTGTCAAAAATTTCACCTGACAAAGCAAAGTTGGTGCAGCCGGAGGGTTTTGACCGTTCAAGTCCCTATGTAGCACCTG
AGATTTATAAAGATGAAATATTTGACCGGAATGCGGACATATATTCATTTGGCATTTTACTCTATGAGATGCTGGAGGGAACACCACCTT
TTAATACCAAGTCTCCAGAAGAGACTGCCAGGTTGATGTGCTTAGAAGGCCAGAGACCAGTATTCAAATCGAAATCCAAATATCCTCCTG
AGCTTAGAGAGTTGATTGAAGAATGTTGGGATCCAGAAGCTTTTGTCCGGCCAACATTTTCTGAGGTCATTGTGCGGATGAATAAAATAT
TTGCTAACTCCTTCAGACAAGGATGGTTGAAAGATACTTTTAAACTTCCTXTGGTTGTAAGTGTACATGAAGGTGTCAAGAAGATGGACA
ATAATTGGGGTCAATGGAGTTTATCAGCGGAAGATTCATGTGGAGCtTTCAATTGATGATAAACCTAATAGGCAAACTTGTAGTCACAAG
ATTCCTTGA(3')AAGCTTTATATTGTCGTTAAACCTAATAAAAGGCAGATTTGCAGGGTGTATGAGATGGGATTACAATGAAATGTTGG
CTTCATAGTAAGTTTGAACTCCACTATATGCCATGTGAAGTTTGTTTATTATGTCTATAGTTTTTGAACCAAATGTATTTCGTCATACAA
GGGGGAAAACAAAAGGTTTATGTAATAAAGGACTGGATATCAAATGCATTACTTTATTGAAATAGTGCTTATGTAAAAAAAAAAAAAAAA
AA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan