ESTScan Details for Unigene SGN-U569664

Score 
788
Direction 
Forward
Predicted Peptide Sequence 
XVQGKNPLIMSDYKIPKINLTKLDKHSNSWVPLCNEVRHALEEHGYFIALYEDANNKISKEIFDVMEELFDLPIETKRKNTSDVYFYRYK
GQLLTAPLHESFGIPHPTDVEALQSFTTLMWPQGNQRFCETMTSYIKVGAEIEQLVDKMVFESYGLPEKHYESHVAATTYLLRPTKYRAA
PAGAEDGIGNVGSNIHTDKGFSAVLFQNQINALQIETKSGEWIPIDVPPSAFVFVAGDAYEAWSNGRIYSPRHQVLMKEDKQRYTLALFT
FNKGITDIPEELVDETHPLQYKPFDNFDLVMYYSTGASPMAYGTAKPYCGINAQ*
Predicted Coding Sequence 
XXGGTTCAAGGTAAAAACCCATTAATTATGAGTGATTACAAAATCCCCAAAATTAATCTCACCAAATTAGACAAGCACTCAAATTCTTGG
GTACCATTATGCAATGAGGTTCGACATGCCCTTGAAGAACATGGTTATTTTATAGCACTATATGAGGATGCTAATAATAAAATTTCCAAG
GAAATATTTGATGTAATGGAAGAATTATTTGATCTCCCCATCGAAACAAAGAGAAAAAACACTTCAGACGTTTACTTCTATCGTTACAAA
GGTCAATTATTAACCGCTCCTCTTCACGAAAGCTTTGGAATCCCACATCCAACTGATGTTGAAGCACTTCAAAGCTTCACCACACTTATG
TGGCCACAAGGCAACCAAAGATTTTGTGAAACAATGACATCGTACATAAAGGTAGGAGCAGAAATAGAACAGTTGGTTGATAAAATGGTG
TTTGAAAGCTACGGATTACCAGAAAAGCACTACGAATCTCATGTCGCAGCTACTACATACCTCCTCCGCCCCACCAAGTACAGAGCAGCA
CCTGCTGGGGCGGAGGACGGTATTGGCAATGTAGGTTCCAATATACATACAGATAAAGGCTTCTCAGCGGTTCTATTTCAGAATCAGATA
AATGCTTTGCAAATCGAAACAAAAAGTGGGGAGTGGATTCCTATTGATGTACCTCCATCTGCATTTGTCTTCGTGGCTGGTGATGCTTAT
GAGGCATGGAGTAATGGAAGAATATATTCACCAAGACACCAAGTGTTGATGAAAGAGGATAAGCAAAGGTATACATTGGCGTTATTCACA
TTCAATAAAGGAATAACAGATATACCTGAGGAATTGGTGGATGAAACACATCCTTTACAATACAAGCCTTTTGATAATTTTGATTTAGTT
ATGTACTACAGTACTGGTGCTAGCCCCATGGCTTATGGCACTGCTAAACCTTACTGTGGTATTAATGCTCAATAG
Edits in Original Sequence 
(5')XXGGTTCAAGGTAAAAACCCATTAATTATGAGTGATTACAAAATCCCCAAAATTAATCTCACCAAATTAGACAAGCACTCAAATTC
TTGGGTACCATTATGCAATGAGGTTCGACATGCCCTTGAAGAACATGGTTATTTTATAGCACTATATGAGGATGCTAATAATAAAATTTC
CAAGGAAATATTTGATGTAATGGAAGAATTATTTGATCTCCCCATCGAAACAAAGAGAAAAAACACTTCAGACGTTTACTTCTATCGTTA
CAAAGGTCAATTATTAACCGCTCCTCTTCACGAAAGCTTTGGAATCCCACATCCAACTGATGTTGAAGCACTTCAAAGCTTCACCACACT
TATGTGGCCACAAGGCAACCAAAGATTTTGTGAAACAATGACATCGTACATAAAGGTAGGAGCAGAAATAGAACAGTTGGTTGATAAAAT
GGTGTTTGAAAGCTACGGATTACCAGAAAAGCACTACGAATCTCATGTCGCAGCTACTACATACCTCCTCCGCCCCACCAAGTACAGAGC
AGCACCTGCTGGGGCGGAGGACGGTATTGGCAATGTAGGTTCCAATATACATACAGATAAAGGCTTCTCAGCGGTTCTATTTCAGAATCA
GATAAATGCTTTGCAAATCGAAACAAAAAGTGGGGAGTGGATTCCTATTGATGTACCTCCATCTGCATTTGTCTTCGTGGCTGGTGATGC
TTATGAGGCATGGAGTAATGGAAGAATATATTCACCAAGACACCAAGTGTTGATGAAAGAGGATAAGCAAAGGTATACATTGGCGTTATT
CACATTCAATAAAGGAATAACAGATATACCTGAGGAATTGGTGGATGAAACACATCCTTTACAATACAAGCCTTTTGATAATTTTGATTT
AGTTATGTACTACAGTACTGGTGCTAGCCCCATGGCTTATGGCACTGCTAAACCTTACTGTGGTATTAATGCTCAATAG(3')ATACCTA
TTTTATTATAAATAATATGAGTTCAAACTAGTTTTACGATGAACTCTATGTGTAATTTCAACTATCTATTTCAAATTCAATATAATATAA
GATTGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan