ESTScan Details for Unigene SGN-U569975

Score 
1102
Direction 
Forward
Predicted Peptide Sequence 
XPLSGADLIRANFHKAPSKPSDNLGFEDQLFSLTVESSDIIQPNEYESFNRLVKLAARAFYDDITTKGDNQPKSGRSDNRGIAVVILDAL
TRRQWVREEDLAKDLKLHTKQLRRTLRFFEEEKLITRDHRKEGAKGAKVYNSAVAATVDGLQNGKEGDDKIKMHTHSYCCLDYAQIYDVV
RYRLHRMKKKLRDELDNKNTVQEYICPNCAKRYTALDALRLVSTEDEYFHCESCNGELVAESDKLASQGSTDGDDNDRRRRREKLEDMLH
RVEAQLKPLMDQLARVKDLPAPEFGSLQAWEVRANAVARGANGDNGNDSKSGQGLGFGGTPMPFVGETKVEVAFSGLEEKGDIKSEVSVT
PMKVLPPWMIKEGMNLTKEQRGEVKQESNMEGTSAAAGSSDDKKVHGFEDVKNIQDEYIKAYYEALFKRQKEQEKTTKLLPETSTTDGVY
YPSTERQVGMK
Predicted Coding Sequence 
XXGCCTCTCTCCGGCGCCGATCTCATCCGCGCTAATTTTCACAAAGCACCTTCAAAACCTAGCGATAATTTGGGATTTGAGGATCAACTT
TTCAGTCTCACTGTTGAAAGTTCGGATATAATTCAGCCAAATGAGTATGAGTCATTCAATAGGTTGGTGAAACTTGCGGCAAGAGCTTTC
TATGACGACATTACAACTAAAGGCGACAACCAGCCCAAGTCCGGTAGAAGTGATAATAGAGGAATTGCAGTGGTGATTCTTGACGCACTC
ACAAGGAGGCAATGGGTGAGGGAAGAAGACTTGGCAAAGGACTTGAAGTTGCACACGAAACAATTACGCCGCACCTTGCGGTTCTTTGAA
GAAGAAAAGCTCATCACACGGGACCATAGGAAGGAGGGAGCAAAGGGTGCTAAAGTATACAATTCTGCAGTTGCAGCTACTGTTGATGGT
CTGCAGAATGGGAAAGAAGGAGATGACAAAATAAAGATGCATACTCATTCTTATTGCTGCCTGGACTATGCACAGATATATGATGTCGTG
AGGTACAGACTGCACCGAATGAAGAAAAAGTTAAGAGATGAGCTGGATAACAAAAACACAGTGCAGGAGTATATTTGTCCCAACTGTGCG
AAAAGATATACTGCGCTGGATGCGTTGCGGCTGGTCTCTACTGAGGATGAGTACTTCCACTGTGAGAGTTGCAATGGGGAACTAGTGGCA
GAGAGCGACAAGCTAGCTTCTCAAGGGTCCACCGATGGGGATGACAATGATAGGAGACGCCGCCGTGAAAAGTTGGAAGACATGCTTCAT
AGGGTGGAGGCACAACTCAAACCATTGATGGATCAACTTGCCAGAGTAAAAGATTTACCTGCTCCTGAGTTTGGAAGCCTTCAAGCATGG
GAAGTGCGAGCCAACGCTGTGGCCCGTGGTGCAAATGGAGATAATGGAAATGACTCAAAGTCAGGACAAGGGCTTGGATTTGGTGGAACA
CCTATGCCGTTTGTAGGGGAGACAAAGGTTGAAGTTGCTTTCTCTGGTCTTGAAGAAAAAGGAGATATCAAATCCGAGGTTTCAGTTACA
CCGATGAAAGTTTTGCCTCCATGGATGATAAAGGAGGGAATGAATCTTACAAAGGAGCAACGTGGAGAGGTCAAGCAAGAATCAAATATG
GAGGGTACTTCTGCTGCAGCAGGATCATCTGATGACAAGAAAGTCCATGGATTTGAAGATGTGAAGAATATACAGGATGAATATATTAAG
GCATATTATGAGGCTCTATTCAAGCGGCAAAAAGAGCAAGAAAAAACTACCAAATTGTTGCCCGAAACATCAACTACAGATGGAGTATAT
TACCCCTCTACTGAACGCCAAGTTGGCATGAAA
Edits in Original Sequence 
(5')XXGCCTCTCTCCGGCGCCGATCTCATCCGCGCTAATTTTCACAAAGCACCgTTCAAAACCTAGCGATAATTTaGGGATTTGAGGAT
CAACTTTTCAGTCTCACTGTaTGAAAGTTCGGATATAATTCAGCCAAATGAGTATcGAGTCATTCAATAGGTTGGTGAAACTTGCGGCAA
GAGCTTTCTATGACGACATTACAACTAAAGGCGACAACCAGCCCAAGTCCGGTAGAAGTGATAATAGAGGAATTGCAGTGGTGATTCTTG
ACGCACTCACAAGGAGGCAATGGGTGAGGGAAGAAGACTTGGCAAAGGACTTGAAGTTGCACACGAAACAATTACGCCGCACCTTGCGGT
TCTTTGAAGAAGAAAAGCTCATCACACGGGACCATAGGAAGGAGGGAGCAAAGGGTGCTAAAGTATACAATTCTGCAGTTGCAGCTACTG
TTGATGGTCTGCAGAATGGGAAAGAAGGAGATGACAAAATAAAGATGCATACTCATTCTTATTGCTGCCTGGACTATGCACAGATATATG
ATGTCGTGAGGTACAGACTGCACCGAATGAAGAAAAAGTTAAGAGATGAGCTGGATAACAAAAACACAGTGCAGGAGTATATTTGTCCCA
ACTGTGCGAAAAGATATACTGCGCTGGATGCGTTGCGGCTGGTCTCTACTGAGGATGAGTACTTCCACTGTGAGAGTTGCAATGGGGAAC
TAGTGGCAGAGAGCGACAAGCTAGCTTCTCAAGGGTCCACCGATGGGGATGACAATGATAGGAGACGCCGCCGTGAAAAGTTGGAAGACA
TGCTTCATAGGGTGGAGGCACAACTCAAACCATTGATGGATCAACTTGCCAGAGTAAAAGATTTACCTGCTCCTGAGTTTGGAAGCCTTC
AAGCATGGGAAGTGCGAGCCAACGCTGTGGCCCGTGGTGCAAATGGAGATAATGGAAATGACTCAAAGTCAGGACAAGGGCTTGGATTTG
GTGGAACACCTATGCCGTTTGTAGGGGAGACAAAGGTTGAAGTTGCTTTCTCTGGTCTTGAAGAAAAAGGAGATATCAAATCCGAGGTTT
CAGTTACACCGATGAAAGTTTTGCCTCCATGGATGATAAAGGAGGGAATGAATCTTACAAAGGAGCAACGTGGAGAGGTCAAGCAAGAAT
CAAATATGGAGGGTACTTCTGCTGCAGCAGGATCATCTGATGACAAGAAAGTCCATaGGATTTGAAGATGTGAAGAATATACAGGATGAA
TATATTAAGGCATATTATGAGGCTCTATTCAAGCGGCAAAAAGAGCAAGAAAAAACTACCAAATTGTTGCCCGAAACATCAACTACAGAT
GGAGTATATTACCCCTCTACTGAACGCCAAGTTGGCATGAAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan