ESTScan Details for Unigene SGN-U570348

Score 
227
Direction 
Forward
Predicted Peptide Sequence 
DVRSTVTNQASXVNTSVTLKNSNWKRSSSGQKSGMPMPNMEESMTEEEFVEWLQNAVEAGMFDDFDGSTPQSPSTPAGSTSKSSSSSTSN
GSGSGNKRKKKXEEAMEYEAHSDPASLNYSRTERPDXEPKLADTSLELIDPMISVDAESSSKHFLGQFKIDCPKVDXINCSLTFWVKCSY
PVLYTELGKESMREMPVENEMWTPSKKSYD*
Predicted Coding Sequence 
GATGTCCGGTCAACAGTCACAAACCAAGCTTCCAXTGTAAATACTAGTGTAACCTTGAAGAACAGCAATTGGAAGAGAAGTAGCTCAGGA
CAAAAAAGTGGGATGCCAATGCCAAATATGGAAGAGAGCATGACCGAGGAAGAATTTGTCGAGTGGCTACAGAATGCTGTAGAAGCGGGT
ATGTTTGATGATTTTGATGGCAGCACGCCACAGAGCCCATCTACACCAGCTGGAAGTACCTCCAAGAGTAGTAGTAGTAGTACAAGCAAC
GGTAGTGGAAGTGGAAACAAGAGAAAGAAAAAGGXGGAAGAAGCAATGGAGTATGAAGCTCACTCTGATCCTGCCTCCTTGAATTATTCA
AGGACTGAGAGGCCAGATGAXGAGCCAAAATTAGCTGATACTAGCCTGGAATTGATTGACCCCATGATTTCTGTTGACGCAGAATCGTCG
TCTAAGCATTTTCTGGGTCAGTTTAAAATAGATTGCCCAAAAGTTGACAAXATAAATTGTAGTCTCACATTCTGGGTAAAATGTTCCTAC
CCTGTCCTTTATACTGAGTTGGGAAAAGAGAGCATGAGAGAGATGCCTGTTGAAAATGAAATGTGGACTCCAAGCAAAAAGAGTTACGAT
TAA
Edits in Original Sequence 
(5')GATGTCCGGTCAACAGTCACAAACCAAGCTTCCAXTGTAAATACTAGTGTAACCTTGAAGAACAGCAATTGGAAGAGAAGTAGCTC
AGGACAAAAAAGTGGGATGCCAATGCCAAATATGGAAGAGAGCATGACCGAGGAAGAATTTGTCGAGTGGCTACAGAATGCTGTAGAAGC
GGGTATGTTTGATGATTTTGATGGCAGCACGCCACAGAGCCCATCTACACCAGCTGGAAGTACCTCCAAGAGTAGTAGTAGTAGTACAAG
CAACGGTAGTGGAAGTGGAAACAAGAGAAAGAAAAAGGXGGAAGAAGCAATGGtAGTATGAAGCTCACTCTGATCCTGCCTCCTTGAATT
ATTCAAGGACTGAGAcGGCCAGATGAXGAGCCAAAATTAGCTGATACTAGCCTGGAATTGAcTTGACCCCATGATTTCTGTTaGACGCAG
AATCGTCGTCTAAGCATTTTCTGGGTCAGTTTAAAATAGATTGCCCAAAAGTTGACAAXATAAATTGTAGTCTCACATTCTGGGTAAAAT
GTTCCTACCCTGTCCTTTATACTGAGTTGGGAAAAGAGAGCATGAGAGAGATGCCTGTTGAAAATGAAATGTGGACTCCAAGCAAAAAGA
GTTACGATTAA(3')GAAAAAGAAAAGAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan