ESTScan Details for Unigene SGN-U570415

Score 
944
Direction 
Forward
Predicted Peptide Sequence 
MDEASRDGPTNKVRARMSIASALIFGSVSGGWADHKRQYKTGWDXLQVAAINTAMAALTKTVGVFPKERAIVDRERAKGSYALGPYLLSK
LIAEIPVGAAFPLLFGGILYPMARLHPTISRFGKFCAIVTVESFAASAMGLTVGAMVPTTEAALALGPSLMTVFIVFGGYYVNSDNTPII
FQWIPRVSLIRWAFQGLSINEFSGLQFEHQKTSDIQSGEQVLERLSFGSSRIGDTIIAQSRILMFWYYTTYLLLEKNKPKYQRLEPPLRL
KDIEEEPEEEAKLQPVKDDDLPEPTQQVESPPSDEGKPDEQQESSPADPLDXVYP*
Predicted Coding Sequence 
ATGGATGAAGCTTCTCGTGATGGACCAACAAACAAAGTTCGGGCAAGGATGTCAATTGCTTCAGCTTTGATATTTGGTTCTGTTTCTGGA
GGATGGGCAGATCACAAACGTCAATACAAGACAGGATGGGATXTACTTCAGGTTGCTGCAATAAACACTGCTATGGCTGCTCTCACAAAA
ACAGTTGGTGTCTTTCCCAAGGAACGAGCAATTGTTGATAGAGAGCGTGCAAAAGGGTCTTATGCTCTGGGACCATATTTGCTTTCCAAG
TTGATTGCTGAGATTCCTGTTGGGGCAGCATTTCCTCTACTCTTTGGTGGCATCCTATACCCAATGGCTCGACTTCATCCTACCATTTCT
AGATTTGGGAAGTTCTGCGCAATCGTGACGGTGGAGTCTTTTGCTGCATCTGCTATGGGCTTGACTGTGGGAGCTATGGTTCCAACGACT
GAAGCTGCATTAGCGTTAGGCCCCTCTCTTATGACAGTTTTTATTGTCTTTGGAGGGTACTATGTCAATTCAGACAACACACCAATTATT
TTTCAGTGGATTCCTCGAGTTTCTTTAATAAGATGGGCGTTTCAGGGGCTTAGCATCAATGAATTTAGTGGCCTTCAGTTTGAGCATCAA
AAGACATCTGACATACAGTCTGGTGAACAGGTACTCGAGCGGCTATCATTTGGAAGCAGCCGAATAGGTGATACCATTATTGCTCAAAGT
AGAATACTCATGTTTTGGTATTACACAACTTACCTTCTCCTGGAGAAAAATAAGCCCAAGTATCAACGGCTTGAACCTCCACTGCGTCTC
AAAGATATCGAAGAAGAGCCAGAGGAAGAAGCAAAGCTTCAGCCCGTAAAGGATGATGATTTGCCTGAACCAACTCAACAAGTTGAATCT
CCCCCCTCAGATGAAGGTAAACCCGACGAGCAGCAGGAATCTTCTCCTGCTGATCCACTTGATXCTGTTTACCCTTGA
Edits in Original Sequence 
CTTTATAGTGCCGAATTCGGCACGAGGGGTGGTTGGTGGACCCTTTTCAGGTTACTTCTCAAACGTGC(5')ATGGATGcAAGCTTCTCG
TGATGGACCAACAAACAAAGTTCGGGCAAGGATGTCAATTGCTTCAGCTTTGATATTTGGTTCTGTaTTCTGGAGGATGGGCAGATCACA
AACGTCAATACAAGACAGGATGGGATXTACTTCAGGTTGCTGCAATAAACACTGCTATGGCTGCTCTCACAAAAACAGTTGGTGTCTTTC
CCAAGGAACGAGCAATTGTTGATAGAGAGCGTGCAAAAGGGTCTTATGCTCTGGGACCATATTTGCTTTCCAAGTTGATTGCTGAGATTC
CTGTTGGGGCAGCATTTCCTCTACTCTTTGGTGGCATCCTATACCCAATGGCTCGACTTCATCCTACCATTTCTAGATTTGGGAAGTTCT
GCGCAATCGTGACGGTGGAGTCTTTTGCTGCATCTGCTATGGGCTTGACTGTGGGAGCTATGGTTCCAACGACTGAAGCTGCATTAGCGT
TAGGCCCCTCTCTTATGACAGTTTTTATTGTCTTTGGAGGGTACTATGTCAATTCAGACAACACACCAATTATTTTTCAGTGGATTCCTC
GAGTTTCTTTAATAAGATGGGCGTTTCAGGGGCTTAGCATCAATGAATTTAGTGGCCTTCAGTTTGAGCATCAAAAGACATCTGACATAC
AGTCTGGTGAACAGGTACTCGAGCGGCTATCATTTGGAAGCAGCCGAATAGGTGATACCATTATTGCTCAAAGTAGAATACTCATGTTTT
GGTATTACACAACTTACCTTCTCCTGGAGAAAAATAAGCCCAAGTATCAACGGCTTGAACCTCCACTGCGTCTCAAAGATATCGAAGAAG
AGCCAGAGGAAGAAGCAAAGCTTCAGCCCGTAAAGGATGATGATTTGCCTGAACCAACTCAACAAGTTGAATCTCCCCCCTCAGATGAAG
GTAAACCCGACGAGCAGCAGGAATCTTCTCCTGCTGATCCACTTGATXCTGTTTACCCTTGA(3')CGGCTTGTNAATTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan