ESTScan Details for Unigene SGN-U570482

Score 
451
Direction 
Forward
Predicted Peptide Sequence 
MANVMKPLMNWPKWHHYLYVRASFIHFVQSQSQSPLFSTCNVRRLPSFTASPSGYRQAHFRSGAALKSRESPLPLDQSEGDSDSDEKTRK
SRNEKKREARRAVRWAMDLAKFSAPQIKRILRVASTEQEVYEAVMLAKRLGPDVREGKRRQFSYIGRLLREVKPELMDGLIQATKDGDQT
KFQALSGSELSATEDVDEEVEETEYEDDEESSEDNIALADRWFDGLVNKDVDISKESIXLSEVDFDRPGVRGLVRNVQSIREKREQSDEG
EGKVNTDVX
Predicted Coding Sequence 
ATGGCTAATGTAATGAAGCCTCTGATGAATTGGCCAAAATGGCATCACTATTTATACGTTCGCGCTTCATTCATCCACTTTGTTCAATCT
CAATCTCAATCTCCACTCTTCTCAACCTGCAATGTTCGCCGACTGCCGTCGTTCACGGCATCACCTTCCGGTTACCGGCAAGCTCATTTT
CGTTCCGGCGCGGCACTTAAATCACGTGAAAGTCCATTACCGTTAGATCAATCAGAGGGCGACAGCGATTCCGATGAAAAAACAAGGAAG
AGTCGTAACGAGAAGAAGCGTGAAGCTCGACGCGCCGTCCGGTGGGCTATGGATTTAGCTAAGTTCTCTGCTCCTCAAATTAAGCGCATT
CTCAGAGTGGCTTCAACGGAGCAAGAGGTATACGAAGCCGTTATGCTGGCCAAGAGACTAGGTCCTGATGTACGAGAAGGAAAGCGAAGG
CAATTCAGTTACATAGGTAGATTATTGCGAGAAGTTAAGCCTGAATTGATGGATGGTTTAATTCAGGCAACAAAAGATGGAGACCAAACT
AAATTTCAGGCTTTATCTGGTTCGGAACTTTCGGCTACCGAAGATGTTGATGAGGAAGTTGAAGAGACTGAATATGAGGATGACGAAGAG
AGTTCTGAGGACAATATTGCTTTAGCCGATAGATGGTTTGATGGCTTGGTCAATAAGGACGTTGACATCTCTAAAGAATCTATTXCTCTA
AGTGAGGTTGATTTTGATCGCCCAGGAGTACGTGGTCTTGTTAGGAATGTACAATCAATACGTGAAAAAAGGGAGCAATCAGACGAAGGG
GAAGGGAAAGTAAACACTGATGTTGXX
Edits in Original Sequence 
CAAAA(5')ATGGCTAATGTAATGAAGCCTCTGATGAATTGGCCAAAATGGCATCACTATTTATACGTTCGCGCTTCATTCATCCACTTT
GTTCAATCTCAATCTCAATCTCCACTCTTCTCAACCTGCAATGTTCGCCGACTGCCGTCGTTCACGGCATCACCTTCCGGTTACCGGCAA
GCTCATTTTCGTTCCGGCGCGGCACTTAAATCACGTGAAAGTCCATTACCGTTAGATCAATCAGAGGGCGACAGCGATTCCGATGAAAAA
ACAAGGAAGAGTCGTAACGAGAAGAAGCGTGAAGCTCGACGCGCCGTCCGGTGGGCTATGGATTTAGCTAAGTTCTCTGCTCCTCAAATT
AAGCGCATTCTCAGAGTGGCTTCAACGGAGCAAGAGGTATACGAAGCCGTTATGCTGGCCAAGAGACTAGGTCCTGATGTACGAGAAGGA
AAGCGAAGGCAATTCAGTTACATAGGTAGATTATTGCGAGAAGTTAAGCCTGAATTGATGGATGGTTTAATTCAGGCAACAAAAGATGGA
GACCAAACTAAATTTCAGGCTTTATCTGGTTCGGAACTTTCGGCTACCGAAGATGTTGATGAGGAAGTTGAAGAGACTGAATATGAGGAT
GACGAAGAGAGTTCTGAGGACAATATTGCTTTAGCCGATAGATGGTTTGATGGCTTGGTCAATAAGGACGTTGACATCTCTAAAGAATCT
ATTXCTCTAAGTGAGGTTGATTTTGATCGCCCAGGAGTACGTGGTCTTGTTAGGAATGTACAATCAATACGTGAAAAAAGGGAGCAATCA
GACGAAGGGGAAGGGAAAGTAAACACTGATGTTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan