ESTScan Details for Unigene SGN-U570653

Score 
612
Direction 
Forward
Predicted Peptide Sequence 
MAKKRKSLASSIDEVDRTMYSTFSSAANSLSQLYSQALNQQKLSFQAGERHGLEKMYQWILRQQEGGSRVTTADMMNYLQSELDYSGEDH
SMSPRPPQNQHSQPMLFPNSGFPVSSGSIGVAAPGHDVRLHHDPQSKNYVFSNALSSPVRQSLQNYQVAQGGYFSNNVQLSIGARNNETN
LHHQNGDSNSYNSADAAMDMHSDSPGHDFLAEEFVYRMFWELLLVMPWYSSSKFRLIDCRXVAAVVREKMPLLNWVYDSEIXKVRSCWLV
NHHSVDMLLTKMQRDGHNTC*
Predicted Coding Sequence 
ATGGCGAAGAAGAGGAAGTCTTTGGCATCAAGTATCGATGAGGTGGATCGAACCATGTACTCAACGTTTAGTAGCGCAGCGAATTCGCTT
TCACAGCTTTATAGTCAGGCTTTGAATCAACAGAAGCTTTCATTTCAGGCCGGTGAACGACATGGATTGGAGAAAATGTATCAATGGATC
TTGAGGCAACAAGAGGGAGGATCCAGAGTAACAACTGCTGACATGATGAACTACCTGCAGTCGGAACTGGACTACAGTGGAGAGGACCAT
TCAATGTCGCCTAGACCACCGCAGAACCAACATTCTCAACCAATGCTTTTTCCAAATTCAGGCTTCCCTGTCTCTTCAGGCTCAATTGGT
GTTGCAGCTCCAGGACATGATGTACGATTACATCATGATCCACAATCAAAGAATTATGTTTTCTCAAATGCTCTTTCAAGCCCTGTTCGG
CAAAGCCTGCAGAATTATCAAGTTGCTCAAGGAGGTTACTTTTCAAACAATGTTCAGCTATCAATTGGAGCAAGAAACAACGAAACCAAC
CTCCACCACCAAAATGGGGATTCCAATAGCTATAACTCAGCTGATGCTGCCATGGATATGCATTCTGATAGCCCTGGTCATGATTTTCTT
GCTGAAGAATTTGTATATAGAATGTTTTGGGAGCTGCTTCTTGTCATGCCGTGGTATTCAAGCAGCAAGTTCAGGTTGATTGATTGTCGT
GXTGTAGCAGCTGTTGTCAGGGAGAAAATGCCGTTATTGAATTGGGTGTATGATTCAGAGATTGAXAAGGTGCGTTCGTGTTGGCTAGTA
AATCATCATTCTGTTGACATGCTCTTAACTAAAATGCAACGTGATGGGCACAATACTTGCTGA
Edits in Original Sequence 
GCAGCTGTTATAAGAAAGCTATACACATTAGCTTCCAATTACAGTTTTCACGCCTCCTCTCTTCATTGGCCCATCGCCGCCGTCGCCGTC
CGATCGACGGAGATTTATCCAACCTTAAGTTATCCAAACGTAGAGTCAGTTGTTTTTTTTTGGTTGGGGTTTAG
(5')ATGGCGAAGAAG
AGGAAGTCTTTGGCATCAAGTATCGATGAGGTGGATCGAACCATGTACTCAACGTTTAGTAGCGCAGCGAATTCGCTTTCACAGCTTTAT
AGTCAGGCTTTGAATCAACAGAAGCTTTCATTTCAGGCCGGTGAACGACATGGATTGGAGAAAATGTATCAATGGATCTTGAGGCAACAA
GAGGGAGGATCCAGAGTAACAACTGCTGACATGATGAACTACCTGCAGTCGGAACTGGACTACAGTGGAGAGGACCATTCAATGTCGCCT
AGACCACCGCAGAACCAACATTCTCAACCAATGCTTTTTCCAAATTCAGGCTTCCCTGTCTCTTCAGGCTCAATTGGTGTTGCAGCTCCA
GGACATGATGTACGATTACATCATGATCCACAATCAAAGAATTATGTTTTCTCAAATGCTCTTTCAAGCCCTGTTCGGCAAAGCCTGCAG
AATTATCAAGTTGCTCAAGGAGGTTACTTTTCAAACAATGTTCAGCTATCAATTGGAGCAAGAAACAACGAAACCAACCTCCACCACCAA
AATGGGGATTCCAATAGCTATAACTCAGCTGATGCTGCCATGGATATGCATTCTGATAGCCCTGGTCATGATTTTaCTTGCTGAAGtAAT
TTGTATATAGAATGTTTTGGGAGCTGCTTCTTGTCATGCCGTGGTATTCAAGCAGCAAGTTCAGGTTGATTGATTGTCGTGXTGTAGCAG
CTGTTGTCAGGGAGAAAATGCCGTTATTGAATTGGGTGTATGATTCAGAGATTGAXAAGGTGCGTTCGTGTTGGCTAGTAAATCATCATT
CTGTTGACATGCTCTTAACgTAAAATGCAACGTGATGGGCACAATACTTGCTGA(3')ATATACTGTTGTTTCTGTTGAACTAGTTAGTT
CTTTTCGGTCTTCTATGATGTTTATGGAGTATTATTTTAGTAAGGTATAAATATATATAGATATATGAATGTGCTCATCTGTTGCGACTT
GTGACGTTCGATTGCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan