Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U570786

Score 
326
Direction 
Forward
Predicted Peptide Sequence 
MGFGGDAXPYLYLKGREVVSDGRNIIIQHNLVSTNGDKXITTKYVEIIAPALHHLNKITCNLHLSSKGNTKTEALFPXDRLDIASSSITR
IKVHLSDCPDXPLELISAQSSHEPESFAEASNHSCWRDAIQEEINAQEKNNKXLVSLPAGKEAIGCKWIYKIKHKADGSVDRYKARLVAK
GFFKNIESNPFPYSQVAQGPPLEKGKHLLQVAKHHSWHSCLGCNQKVALFQFDVQNRMPFNNIREGGKNXVSIQPPPTPGFSSPRNPNLV
CKLKKAIYVTASGKLKQAQELGLKGDSSMYKSRNRSRGRSRFSNK*
Predicted Coding Sequence 
ATGGGGTTTGGAGGAGACGCAXCACCTTACCTTTACCTTAAAGGTAGAGAAGTTGTTTCTGATGGACGGAATATCATAATACAACATAAT
TTGGTCTCCACTAATGGTGATAAGGXTATTACTACAAAGTATGTTGAGATAATAGCACCAGCTTTGCATCACCTGAACAAAATTACATGT
AATTTACATCTTTCCTCTAAAGGTAATACCAAAACTGAGGCCCTTTTTCCTCXTGACCGTCTCGACATTGCAAGTTCATCAATTACAAGA
ATAAAGGTTCATCTCTCAGATTGTCCGGACXTGCCACTAGAACTCATCTCAGCTCAATCTTCACATGAACCTGAATCATTTGCTGAAGCC
TCCAATCATTCTTGCTGGAGAGATGCTATACAGGAAGAAATCAATGCCCAGGAAAAAAATAATAAGAXCTTAGTCTCATTGCCTGCAGGG
AAAGAAGCCATTGGCTGCAAGTGGATTTACAAGATCAAGCATAAAGCAGATGGCTCGGTAGATAGATACAAGGCTAGATTAGTAGCTAAA
GGATTCTTCAAGAATATTGAGTCGAACCCCTTTCCTTACAGTCAAGTGGCCCAAGGGCCCCCTTTAGAGAAGGGAAAACATTTGCTTCAG
GTTGCTAAACACCATTCGTGGCATTCTTGCCTTGGCTGCAATCAAAAGGTGGCCTTATTTCAATTTGACGTGCAGAATAGAATGCCTTTC
AACAACATAAGGGAAGGGGGCAAGAATAXAGTTTCTATTCAGCCTCCTCCAACTCCAGGCTTCTCTTCTCCTAGGAATCCTAACTTGGTA
TGCAAGCTCAAGAAAGCGATTTATGTTACGGCCTCCGGCAAGCTAAAGCAGGCACAAGAGCTTGGTTTGAAAGGTGACAGCAGCATGTAT
AAGAGCCGAAATAGGAGTAGAGGAAGGAGCCGGTTTTCAAATAAGTAA
Edits in Original Sequence 
AACCAGAAAGTGAATTACAGTAATACAATAATATACATGATTTAGCAAGTCAAATAGACCTAATCATCTCTTTCATTTCTGTATACAACA
ACATAGCCAGTGTAATCCTACAGA
(5')ATGGGGTTTGGAGGAGACGCAXCACCTTACCTTTACCTTAAAGGTAGAGAAGTTGTTTCTGA
TGGACGGAATATCATAATACAACATAATTTGGTCTCCACTAATGGTGATAAGGXTATTACTACAAAGTATGTTGAGATAATAGCACCAGC
TTTGCATCACCTGAACAAAATTACATGTAATTTACATCTTTCCTCTAtAAGGTAATACCAAAACTGAGGCCCTTTTTCCTCXTGACCGTC
TCGACATTGCAAGTTCATCAATTACAAGAATAAAGGTTCATCTCTCAGATTGTCCGGACXTGCCACTAGAACTCATCTCAGCTCAATCTT
CACATGAACCTGAATCATTTGCTGAAGCCTCCAATCATTCTTGCTGGAGAGATGCTATACAGGAAGAAATCAATGCCCAGGAAAAAAATA
ATAAGAXCTTAGTCTCATTGCCTGCAGGGAAAGAAGCCATTGGCTGCAAGTGGATTTACAAGATCAAGCATAAAGCAGATGGCTCGGTAG
ATAGATACAAGGCTAGATTAGTAGCTAAAGGATTcCTTCAAGAATATTGAGTCGAACCCCTTTCCTTACAGTCAAGTGGCCCAAGGGCCC
CCTTTAGAGAtAGGGAAAACATTTGCTTCAGGTTGCTAAACACCATTCGTGGCATTCTTGCCTTGGCTGCAATCAAAAGGTGGCCTTATT
TCAATTTGACGTGCAGAATAGAATGCCTTTCAACAACATAAGGGAAGGGGGCAAGAATAXAGTTTCTATTCAGCCTCCTCCAACTCCAGG
CTTCTCTTCTCCTAGGAATCCTAACTTGGTATGCAAGCTCAAGAAAGCGATTTATGTTACGGCCTCCGGCAAGCTAAAGCAGGCACAAGA
GCTTGGTTTGAAAGGTGACAGCAGCATGTATAAGAGCCGAAATAGGAGTAGAGGAAGGAGCCGGTTTTCAAATAAGTAA(3')ATCGGAT
CATTCAATGTTTATAAGGAGGTCGACATCAGGTATTGTCCTTCTTCTGCGTGGATGACATTGCTTTCTCTAGTAATGACTTAGCCTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan