ESTScan Details for Unigene SGN-U570955

Score 
530
Direction 
Forward
Predicted Peptide Sequence 
MEFDSIECVSSSDGIEEDEIPQLHPHIIRSQFSSSKTTTHKNNNGSSILCEGNNGGIAIHPATSVHELLECPVCTNSMYPPTISVIMGTL
SVQHVKPGYTTDVPLVDRSLVISDXLALEKVAESLELPCKFGSLGCPEIFPYYSKLKHEAACNFRPYNCPYAGSECAAVGDIPYLVTHLR
DDHKVDMHSGCTFNHRYVKSNPREVENATWMLTVFNCFGQYFCLHFEAFQLGMAPVYMAFLRFMGDETDAQNYTYXPGSRGKRKEAYLGG
YTPSIRDSHRKVRDSHDGLVIQRNMALFFSGGDRKELKLRVTGRIWKEQQNPDEGACIPNLCS*
Predicted Coding Sequence 
ATGGAGTTTGATAGCATTGAATGTGTATCATCTTCTGATGGTATAGAGGAAGATGAGATTCCACAACTTCATCCACATATCATTCGTTCT
CAGTTTTCGTCCTCAAAGACGACGACCCACAAGAACAACAACGGAAGCAGTATCTTGTGTGAAGGAAATAATGGGGGAATTGCAATTCAT
CCAGCGACTAGCGTTCATGAGCTTCTTGAATGCCCTGTTTGTACCAATTCTATGTACCCTCCAACCATCAGTGTCATAATGGGCACACTA
TCTGTTCAACATGTAAAGCCAGGGTACACAACCGATGTCCCACTTGTAGACAGGAGCTTGGTGATATCAGATGXTTTAGCATTGGAAAAG
GTGGCTGAATCACTTGAGCTACCTTGTAAATTTGGCTCTCTTGGATGTCCTGAAATATTTCCTTATTACAGTAAGCTGAAACATGAGGCT
GCCTGTAATTTTAGACCATACAACTGCCCGTATGCTGGGTCAGAGTGTGCAGCTGTTGGGGATATTCCTTATTTGGTTACTCATTTGAGG
GATGATCACAAGGTAGACATGCACTCTGGATGCACTTTTAACCATCGCTATGTCAAATCTAATCCCCGAGAAGTGGAAAATGCTACGTGG
ATGTTAACAGTTTTCAATTGTTTTGGTCAGTACTTTTGTCTCCATTTCGAAGCATTTCAGCTTGGAATGGCTCCCGTTTACATGGCGTTC
CTCCGTTTTATGGGAGACGAGACAGATGCACAAAACTACACCTACAXGCCTGGAAGTAGGGGGAAACGGAAGGAAGCTTATCTGGGAGGG
TACACCCCAAGCATAAGAGACAGTCATAGGAAAGTTAGGGATAGCCATGATGGTCTCGTTATCCAACGTAACATGGCCCTTTTCTTCTCC
GGAGGAGACAGAAAGGAGCTCAAGCTAAGAGTCACTGGAAGAATATGGAAGGAACAACAGAATCCAGACGAAGGAGCTTGCATACCAAAT
CTCTGTAGTTAA
Edits in Original Sequence 
AACCCACCTCCCCACCATCCCGCTCCTCTGTTTTCCTCTTTTTGAAAATCAAACAATTGTTTATAGTATAGAGACCCCCCAACCCCAACG
AAAACCCCTCAATAATTCCACAAAATTTACTCAAAAAGAGGATTTGTTTTCATCAGTTCTTGATTTTGATTGAATCAAGAATTGAATACA
TTTTGTTGAATGA
(5')ATGGAGTTTGATAGCATTGAATGTGTATCATCTTCTGATGGTATAGAGGAAGATGAGATTCCACAACTTCATC
CACATATCATTCGTTCTCAGTTTTCGTCCTCAAAGACGACGACCCACAAGAACAACAACGGAAGCAGTATCTTGTGTGAAGGAAATAATG
GGGGAATTGCAATTCATCCAGCGACTAGCGTTCATGAGCTTCTTGAATGCCCTGTTTGTACCAATTCTATGTACCCTCCAAtCCATCAGT
GTCATAATGGGCACACTATCTGTTCAACATGTAAAGCCAGGGTACACAACCGATGTCCCACTTGTAGACAGGAGCTTGGTGATATCAGAT
GXTTTAGCATTGGAAAAGGTGGCTGAATCACTTGAGCTACCTTGTAAATTTGGCTCTCTTGGATGTCCTGAAATATTTCCTTATTACAGT
AAGCTGAAACATGAGGCTGCCTGTAATTTTAGACCATACAACTGCCCGTATGCTGGGTCAGAGTGTGCAGCTGTTGGGGATATTCCTTAT
TTGGTTACTCATTTGAGGGATGATCACAAGGTAGACATGCACTCTGGATGCACTTTTAACCATCGCTATGTCAAATCTAATCCCCGAGAA
GTGGAAAATGCTACGTGGATGTTAACAGTTTTCAATTGTTTTGGTCAGTACTTTTGTCTCCATTTCGAAGCATTTCAGCTTGGAATGGCT
CCCGTTTACATGGCGTTCCTCCGTTTTATGGGAGACGAGACAGATGCACAAAACTACACCTACAXGCCTGGAAGTAGGGGGAAACGGAAG
GAAGCTTATCTGGGAGGGTACACCCCgAAGCATAAGAGACAGTCATAGGAAAGTTAGGGATAGCCATGATGGTCTCGTTATCCAACGTAA
CATGGCCCTTTTCTTCTCCGGAGGAGACAGAAAGGAGCTCAAGCTAAGAGTCACTGGAAGAATATGGAAGGAACAACAGAATCCAGACGA
AGGAGCTTGCATACCAAATCTCTGTAGTTAA(3')ATGCTGCTTGCATTTTAATCTATTGGGTTTTGTTATTCTTGCCTGTCCTATGTTC
TGTATTTTTGGCTTAATGGCACTGTTTCTTTCCTAATGTCATAAGTAAATTCAGATTCCCCATAATATGTATGAAAAAAGCTTAAGTTGT
TGTTATCCATCAATTAATAAGTTTTCTTGTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan