ESTScan Details for Unigene SGN-U571014

Score 
1108
Direction 
Forward
Predicted Peptide Sequence 
MDESKEETKSFKELGVCDQLIEACDNLGWKNPSKIQAEAMPHAFEGKDLIGLAQTGSGKTGAFAIPILQSLLDSPHAFFACVLSPTRELA
IQIAEQFEALGSGIGVKCAVLVGGIDQVQQSIALGKRPHIVVATPGRXLGSSFQYQRVFSPYDKVLGIR*GGQVANEDFEKALDQILNAI
PHERRTYLFSATMTKKVRKLQRACLRNPVKIEAASKYSTVDTLKQQYRFLPAKYKDCYLIYILTEMSGSTSMVFTRTCDATRLLALMLRN
LGLRAIPISGQMTQDKRLGALNKFKAGECNILICTDVASRGLDIPSVDMVINYDIPTNSKDYIHRVGRTARAGRSGVAISLVNQYELEWY
IQIEKLIGKKLPEYPAEEEEVLLLLERVTEAKRISLMKIKETGGKRKHRGGGDDGDDQEVHKYLGVNKKGKQSKKPKRK*
Predicted Coding Sequence 
ATGGATGAATCCAAAGAAGAAACGAAGTCTTTCAAAGAATTAGGAGTTTGTGATCAATTGATTGAGGCTTGTGATAATTTGGGTTGGAAA
AACCCTTCTAAGATACAAGCTGAAGCTATGCCTCATGCCTTTGAAGGCAAAGACCTAATTGGTCTGGCACAAACGGGTTCTGGAAAGACG
GGAGCTTTTGCAATTCCTATACTGCAATCCTTATTAGATTCTCCGCATGCCTTTTTTGCCTGTGTTCTCTCTCCAACAAGAGAGCTCGCC
ATTCAAATTGCTGAACAGTTTGAAGCTTTAGGATCCGGTATTGGAGTAAAATGTGCAGTGCTGGTTGGAGGGATAGATCAAGTACAACAG
AGCATTGCCCTCGGGAAACGACCTCACATTGTTGTTGCAACACCTGGTCGCCXTCTTGGATCATCTTTCCAATACCAAAGGGTTTTCTCT
CCGTACGATAAAGTACTTGGTATTAGATGAGGCGGACAGGTTGCAAATGAGGATTTTGAGAAGGCCCTCGATCAGATTTTGAATGCTATT
CCCCATGAACGAAGGACTTATCTCTTTTCTGCTACAATGACCAAAAAGGTGCGGAAACTTCAGAGGGCTTGTTTGAGAAATCCTGTTAAG
ATTGAAGCTGCATCTAAATATTCCACCGTTGATACACTGAAGCAGCAGTATCGTTTTCTTCCTGCTAAATATAAGGACTGCTATCTTATC
TATATTCTGACTGAGATGTCTGGCAGTACATCTATGGTTTTCACTCGCACATGTGATGCAACTCGTCTTCTGGCTTTGATGCTTCGCAAC
CTAGGCTTGAGAGCCATACCAATTAGTGGTCAGATGACTCAGGATAAAAGGCTTGGAGCTCTAAACAAATTTAAGGCCGGAGAGTGCAAT
ATCCTTATATGCACTGATGTGGCCAGTCGAGGACTTGATATACCGTCTGTTGATATGGTTATCAACTATGATATTCCAACAAACTCAAAG
GATTATATACATAGAGTGGGAAGAACTGCACGAGCAGGACGTTCCGGGGTTGCCATATCATTAGTAAATCAGTATGAGTTGGAGTGGTAT
ATACAGATAGAAAAGCTTATTGGGAAGAAACTACCCGAGTATCCCGCAGAGGAAGAGGAGGTTTTGCTACTCTTGGAGCGTGTCACAGAA
GCCAAAAGGATCTCATTGATGAAAATCAAAGAAACTGGTGGGAAAAGGAAACACAGAGGTGGTGGAGATGATGGTGACGATCAAGAGGTT
CATAAATACTTGGGAGTTAATAAGAAGGGAAAACAATCAAAGAAGCCAAAGAGAAAATGA
Edits in Original Sequence 
GCTTGGTTTTTTCTTCTTTCTTCTCCGGCGTCTCTTCACTTCTCTCTGCGTAATTTTTCTGCGTTTCTTCTCTGCGATTCTCGTTACTGT
CATAATAGAACCCTCTGTGGAGAAGTCTTGGATCTGCGGCTAA
(5')ATGGATGAATCCAAAGAAGAAACGAAGTCTTTCAAAGAATTAG
GAGTTTGTGATCAATTGATTGAGGCTTGTGATAATTTGGGTTGGAAAAACCCTTCTAAGATACAAGCTGAAGCTATGCCTCATGCCTTTG
AAGGCAAAGACCTAATTGGTCTGGCACAAACGGGTTCTGGAAAGACGGGAGCTTTTGCAATTCCTATACTGCAATCCTTATTAGATTCTC
CGCATGCCTTTTTTGCCTGTGTTCTCTCTCCAACAAGAGAGCTCGCCATTCAAATTGCTGAACAGTTTGAAGCTTTAGGATCCGGTATTG
GAGTAAAATGTGCAGTGCTGGTTGGAGGGATAGATCAAGTACAACAGAGCATTGCCCTCGGGAAACGACCTCACATTGTTGTTGCAACAC
CTGGTCGCCXTCTTGGATCATCTTTCCAATACCAAAGGGTTTTCTCTCCGTACGATAAAGTACTTGGTATTAGATGAGGCGGACAGGTTG
CtAAATGAGGATTTTGAGAAGGCCCTCGATCAGATTTTGAATGCTATTCCCCATGAACGAAGGACTTATCTCTTTTCTGCTACAATGACC
AAAAAGGTGCGGAAACTTCAGAGGGCTTGTTTGAGAAATCCTGTTAAGATTGAAGCTGCATCTAAATATTCCACCGTTGATACACTGAAG
CAGCAGTATCGTTTTCTTCCTGCTAAATATAAGGACTGCTATCTTATCTATATTCTGACTGAGATGTCTGGCAGTACATCTATGGTTTTC
ACTCGCACATGTGATGCAACTCGTCTTCTGGCTTTGATGCTTCGCAACCTAGGCTTGAGAGCCATACCAATTAGTGGTCAGATGACTCAG
GATAAAAGGCTTGGAGCTCTAAACAAATTTAAGGCCGGAGAGTGCAATATCCTTATATGCACTGATGTGGCCAGTCGAGGACTTGATATA
CCGTCTGTTGATATGGTTATCAACTATGATATTCCAACAAACTCAAAGGATTATATACATAGAGTGGGAAGAACTGCACGAGCAGGACGT
TCCGGGGTTGCCATATCATTAGTAAATCAGTATGAGTTGGAGTGGTATATACAGATAGAAAAGCTTATTGGGAAGAAACTACCCGAGTAT
CCCGCAGAGGAAGAGGAGGTTTTGCTACTCTTGGAGCGTGTCACAGAAGCCAAAAGGATCTCATTGATGAAAATCAAAGAAACTGGTGGG
AAAAGGAAACACAGAGGTGGTGGAGATGATGGTGACGATCAAGAGGTTCATAAATACTTGGGAGTTAATAAGAAGGGAAAACAATCAAAG
AAGCCAAAGAGAAAATGA(3')GGGAATTAATGTGTAAACTAATTTAGCAATTGTTTAGTCCAATTTTGACTTGGTTATTTATTTTATTA
TTGTTTACTCATTTAGGGGACTAAATTTGACATTTCATGAATTTGTGTTTTTGTTGTCAATGATAATATTTTCTTATATATACGTATAAA
AAAGTAATTGATACGCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan