ESTScan Details for Unigene SGN-U571123

Score 
826
Direction 
Forward
Predicted Peptide Sequence 
XKPNVSGTSKLEIEPLLESSLSEPHLPNQTSSINPFNHHTTTAAVAVAARKHRKIPANLSDSILDGIIPCGSTWVARWGVQPQSVPKFPV
TNKLSASPFCFSSKIRALASPNSTLFCQESLQALFSSVSNKNHYQRRGTSIVVRAEKDYYDVLGVSRNASKSEIKSSYRKLARSYHPDVN
KEPGAEQKFKEISNAYEVLSDDEKRSIYDKYGEAGLKGAGAGMGDFSNAFDLFESLFDGFGGMGGMGGMGGRGSRSRATEGEDQGYNLVL
NFKEAVFGVEKEIEISRLETCGTCDGSGAKPGTKPSTCNTCGGQGQVVSSARTPLGVFQQVTTCSSCGGTGEISTPWAPATVMAEXRKSK
RISLKVPPGVDSGSRLRVRSEGNAGRRGGPPGDLFVMIEVLPDPVLKRDDTNILYNCKVSYIDAILGTTMKVPTVDGMVDLKIPAGTQPG
TTLVMAKKGVPFLSKPNMRGDQLVRVQVEIPKRLSSEERKLIEELANLNKPKAATXQQEEFVAKATRLFYLSNTSNDQYSGXALPTGTPI
LMLIP*
Predicted Coding Sequence 
XCGAAGCCTAATGTTAGTGGTACAAGTAAACTAGAGATAGAGCCTCTTCTCGAATCTTCTCTTTCGGAGCCTCATCTTCCCAACCAGACT
TCCTCCATCAATCCTTTCAACCACCACACAACTACCGCCGCCGTTGCCGTAGCGGCGCGTAAACATCGCAAAATTCCGGCCAATCTCAGT
GACAGTATATTAGATGGAATCATACCTTGTGGAAGCACATGGGTTGCCCGGTGGGGTGTTCAGCCTCAGTCTGTGCCAAAATTTCCTGTT
ACAAATAAATTATCAGCATCTCCATTTTGTTTCTCAAGCAAGATAAGGGCATTGGCATCCCCAAATTCAACCCTTTTTTGTCAAGAATCC
CTGCAAGCACTTTTCAGTTCAGTATCAAACAAGAACCACTATCAACGAAGGGGGACCAGTATAGTTGTTAGAGCTGAAAAAGATTATTAT
GATGTCCTAGGTGTATCTAGAAATGCTAGCAAATCAGAAATCAAAAGCTCTTATCGAAAGCTTGCAAGGAGTTACCATCCAGATGTGAAC
AAAGAACCTGGAGCTGAACAGAAATTTAAGGAGATCAGCAATGCGTATGAGGTTTTGTCTGATGATGAGAAACGTTCCATATATGATAAA
TATGGGGAGGCTGGTCTTAAAGGAGCTGGTGCGGGCATGGGGGATTTTAGCAACGCCTTTGATTTATTCGAGTCTTTGTTCGACGGCTTT
GGTGGTATGGGTGGCATGGGTGGTATGGGAGGTAGAGGTTCTCGGAGCAGGGCCACAGAAGGTGAAGACCAGGGCTATAATCTGGTTTTG
AATTTCAAAGAAGCTGTATTTGGGGTTGAGAAGGAGATTGAAATTAGCAGGCTTGAAACTTGTGGTACCTGTGATGGATCAGGTGCAAAA
CCTGGGACTAAACCGTCGACCTGTAATACTTGTGGTGGGCAAGGGCAGGTTGTGTCCTCAGCAAGGACCCCACTGGGTGTTTTCCAGCAG
GTGACAACATGCTCTTCTTGTGGGGGGACTGGAGAGATTTCTACTCCTTGGGCACCTGCAACGGTGATGGCCGAGXTGAGGAAGTCAAAA
CGCATTAGCTTGAAAGTTCCACCTGGTGTAGATTCCGGTAGCCGTTTAAGGGTTCGTTCAGAAGGTAATGCAGGAAGGAGAGGTGGACCC
CCCGGAGATCTTTTTGTCATGATTGAAGTCCTCCCGGATCCAGTATTAAAACGGGATGACACCAATATTCTCTACAATTGCAAAGTTTCT
TACATTGATGCGATATTGGGTACCACTATGAAGGTTCCTACAGTAGATGGGATGGTTGATCTAAAGATTCCGGCAGGTACCCAGCCAGGG
ACAACATTGGTGATGGCCAAAAAAGGGGTGCCATTCCTGAGCAAACCAAACATGAGAGGGGATCAATTGGTGAGAGTGCAAGTTGAGATT
CCAAAACGGTTGAGTAGTGAAGAAAGAAAGCTCATAGAAGAACTTGCCAATCTAAACAAGCCTAAAGCTGCTACCAAXCAGCAAGAGGAG
TTTGTAGCTAAAGCAACCAGGTTGTTTTATCTTTCTAATACTTCCAATGATCAATATTCTGGTXATGCTCTACCTACTGGCACACCGATA
TTAATGTTGATTCCTTGA
Edits in Original Sequence 
(5')XCGAAGCCTAATGTTAGTGGTACAAGTAtAACTAGAGATAGAGCCTCTTCTCGAATCTTCTCTTTCGGAGCCTCATCTTCCCAACC
AGACTTCCTCCATCAATCCTTTCAACCACCACACAACTACCGCCGCCGTTGCCGTAGCGGCGCGTAAACATCGCAAAATTCCGGCCAATC
TCAGTGACAGTATATTAGATGGcAATCATACCTTGTGGAAGCACATGGGTTGCCCGGTGGGGTGTTCAGCCTCAGTCTGTGCCAAAATTT
CCTGTTACAAATAAATTATCAGCATCTCCATTTTGTTTCTCAAGCAAGATAAGGGCATTGGCATCCCCAAATTCAACCCTTTTTTGTCAA
GAATCCCTGCAAGCACTTTTCAGTTCAGTATCAAACAAGAACCACTATCAACGAAGGGGGACCAGTATAGTTGTTAGAGCTGAAAAAGAT
TATTATGATGTCCTAGGTGTATCTAGAAATGCTAGCAAATCAGAAATCAAAAGCTCTTATCGAAAGCTTGCAAGGAGTTACCATCCAGAT
GTGAACAAAGAACCTGGAGCTGAACAGAAATTTAAGGAGATCAGCAATGCGTATGAGGTTTTGTCTGATGATGAGAAACGTTCCATATAT
GATAAATATGGGGAGGCTGGTCTTAAAGGAGCTGGTGCGGGCATGGGGGATTTTAGCAACGCCTTTGATTTATTCGAGTCTTTGTTCGAC
GGCTTTGGTGGTATGGGTGGCATGGGTGGTATGGGAGGTAGAGGTTCTCGGAGCAGGGCCACAGAAGGTGAAGACCAGGGCTATAATCTG
GTTTTGAATTTCAAAGAAGCTGTATTTGGGGTTGAGAAGGAGATTGAAATTAGCAGGCTTGAAACTTGTGGTACCTGTGATGGATCAGGT
GCAAAACCTGGGACTAAACCGTCGACCTGTAATACTTGTGGTGGGCAAGGGCAGGTTGTGTCCTCAGCAAGGACCCCACTGGGTGTTTTC
CAGCAGGTGACAACATGCTCTTCTTGTGGGGGGACTGGAGAGATTTCTACTCCTTGcGGCACCTGCAACGGTGATGGCCGAGXTGAGGAA
GTCAAAACGCATTAGCTTGAAAGTTCCACCTGGTGTAGATTCCGGTAGCCGTTTAAGGGTTCGTTCAGAAGGTAATGCAGGAAGGAGAGG
TGGACCCCCCGGAGATCTTTTTGTCATGATTGAAGTCCTCCCGGATCCAGTATTAAAACGGGATGACACCAATATTCTCTACAATTGCAA
AGTTTCTTACATTGATGCGATATTGGGTACCACTATGAAGGTTCCTACAGTAGATGGGATGGTTGATCTAAAGATTCCGGCAGGTACCCA
GCCAGGGACAACATTGGTGATGGCCAAAAAAGGGGTGCCATTCCTGAGCAAACCAAACATGAGAGGGGATCAATTGGTGAGAGTGCAAGT
TGAGATTCCAAAACGGTTGAGTAGTGAAGAAAGAAAGCTCATAGAAGAACTTGCCAATCTAAACAAGCCTAAAGCTGCTACCAAXCAGCA
AGAGGtAGTTTGTAGCTAAAGCAACCAGGTTGTTTTATCTTTCTAATACTTCCAATGATCAATATTCTGGTXATGCTCTACCTACTGGCA
CACCGATATTAATGTTGATTCCTTGA(3')ACTCTACATAGTATAGTCGTAGACATAGACAATTTTGAGGTTTGATTTTGTGTTATGTAC
TGTACCTACACACCAGTGAAATGCTGGAAAAGATCAAGAGGGCTGAGCTAAGATTGTTGATGTCTCAATATTTATTCCAAATTTATCATT
TTCTTGTCCATCAAAAACTGATCTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan