ESTScan Details for Unigene SGN-U571250

Score 
570
Direction 
Reverse
Predicted Peptide Sequence 
XPRDTLSYHTVXFESFKVLANNYLDVTSHDDYFPEIHRLLGETNITPADVAESLMPKSSKENADTCLERLVKAIETAKVEAKLKAEEEKA
EKEKEENENEKKKKEAAAAAEDAKRADDVNENGTSMETKEKPESDGAKENCKSEIVMD*
Predicted Coding Sequence 
XXTCCACGAGACACATTGAGCTATCATACTGTTGXTTTTGAGTCCTTCAAGGTGCTTGCTAATAATTATCTAGACGTTACGTCTCATGAT
GATTACTTTCCTGAGATTCATCGTTTATTAGGGGAAACTAATATAACTCCAGCTGATGTTGCTGAGAGTTTGATGCCCAAGTCTTCTAAG
GAAAATGCAGATACTTGCTTGGAGAGGTTAGTTAAAGCTATTGAAACAGCAAAGGTGGAAGCAAAATTGAAGGCTGAGGAAGAAAAGGCA
GAGAAGGAGAAGGAAGAGAACGAGAACGAAAAGAAAAAGAAAGAAGCAGCAGCTGCTGCAGAAGACGCGAAAAGGGCTGATGATGTGAAC
GAAAATGGGACGTCGATGGAGACTAAGGAAAAGCCAGAAAGTGATGGTGCTAAGGAAAATTGCAAGTCTGAGATAGTAATGGACTAA
Edits in Original Sequence 
(5')XXTCCACGAGACACATTGAGCTATCATACTGTTGXTTTTGAGTCCTTCAAGGTGCTTGCTAATAATTATCTAGACGTTACGTCTCA
TGATGATTACTTTCCTGAGATTCATCGTTTATTAGGGGAAACTAATATAACTCCAGCTGATGTTGCTGAGAGTTTGATGCCCAAGTCTTC
TAAGGAAAATGCAGATACTTGCTTGGAGAGGTTAGTTAAAGCTATTGAAACAGCAAAGGTGGAAGCAAAATTGAAGGCTGAGGAAGAAAA
GGCAGAGAAGGAGAAGGAAGAGAACGAGAACGAAAAGAAAAAGAAAGAAGCAGCAGCTGCTGCAGAAGACGCGAAAAGGGCTGATGATGT
GAACGAAAATGGGACGTCGATGGAGACTAAGGAAAAGCCAGAAAGTGATGGTGCTAAGGAAAATTGCAAGTCTGAGATAGTAATGGACTA
A(3')TGATGATGTTAGTAAAGGGTTAGTAAAGTTTGATCATGGAAATATTTGATCAATTAGGTGTTGCCCATAGAACCAGGATTCAGAT
ATTTTGAATAATTTTGTTGTTGAACATTGTTGATTTTGTTATTCAAGAGATACTATGATGATGTAGGAAGTGGTTGTTGCATAATACATA
GTGTAGTATCTTATCTTTTTGTGGTAACAAATATTTACATCTTAGTAACTTGGTGATATATATCAATTTCCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan