ESTScan Details for Unigene SGN-U571323

Score 
1085
Direction 
Forward
Predicted Peptide Sequence 
XSIKSETFSFFKIEPTIDSSSSRFSVTDSFATQNGQTEVAGVSPKSIIKIILSQHSVSANSMINKGNVCTHVSEYLPTLLKNRSLYSCSF
IGKPNSSSTRRFPPLKHFFHSTGACYSAERDYYEILGVSRDSTRDEIKKAFHVLAKKYHPDANKNNPSAKRKFQEIRDAYEILQNPQKRA
QYDMMKEQPSNNTENINYNHRNGNDFRYTYSTQFSGSFQKIFSEIFENEAENLTQDIQVELSLSFSEAAKGCTKHLSFDADVPCDSCSGL
GYPLNSTPKVCPTCQGVGRVTIPPFTATCSTCKGSGRVIKERCRACKASGVVEAIKDVKVTIPAGVDSGDTIRVPKAGHAGRRGVQPGSL
FIKLKVAKDPLFAREGADLYVDYHISFTKAILGGKVEVPTLSGKTNIQVPKGVQPGQLXGTTRQRFAKEWISGEPWRSIRAVPIDFPTAL
NERQRAIMEEFAQEEVVNGDYMDGEVNLWQQLLERVSNPKFVVXVLTLDSDSSIVNQNTMIVEASAASADTRIPDPAAFNIIPAQSLLFS
GFNLTGENFPNIYSPGSYITYTW
Predicted Coding Sequence 
XGGAGCATAAAAAGTGAAACATTTTCGTTTTTCAAGATTGAACCAACAATTGACAGCAGTAGCTCTAGATTTTCAGTTACAGATTCTTTT
GCAACTCAAAATGGGCAGACTGAGGTGGCAGGAGTTTCCCCAAAATCTATCATTAAAATTATTTTGTCACAGCACTCAGTTTCTGCAAAT
TCGATGATCAATAAAGGGAACGTGTGTACACATGTTTCAGAATATCTACCTACATTACTTAAAAATCGATCTTTGTACAGTTGCAGTTTT
ATTGGTAAACCTAATAGTTCTTCGACTAGGAGATTTCCACCGTTGAAGCATTTTTTCCATTCCACCGGAGCTTGTTATTCTGCAGAACGA
GATTACTATGAAATTCTAGGTGTATCTAGAGATTCTACTCGAGATGAGATTAAGAAGGCTTTTCATGTGCTTGCTAAAAAATACCACCCA
GATGCCAATAAGAATAATCCATCTGCAAAGAGGAAATTTCAAGAGATAAGAGATGCATATGAGATTTTGCAAAACCCACAGAAGAGAGCA
CAATATGACATGATGAAGGAGCAACCAAGCAACAACACAGAAAATATAAATTATAATCATAGGAATGGCAATGATTTTAGATATACATAT
AGCACACAATTCTCTGGTTCGTTTCAGAAAATATTTTCTGAGATATTTGAAAATGAGGCTGAAAATCTGACGCAAGACATTCAGGTGGAG
CTTTCTCTCTCTTTTTCTGAAGCTGCTAAAGGATGCACAAAACATCTTTCATTTGATGCAGATGTACCATGTGATTCTTGCAGTGGTTTG
GGCTATCCATTGAATTCAACTCCAAAAGTATGTCCAACTTGTCAAGGAGTTGGGAGAGTTACAATTCCTCCATTTACAGCAACTTGCAGT
ACCTGTAAAGGATCTGGACGAGTCATTAAGGAACGATGTAGGGCATGCAAAGCATCAGGAGTTGTTGAAGCCATTAAAGACGTTAAAGTA
ACTATACCTGCCGGTGTTGACTCCGGTGATACTATTCGGGTGCCAAAAGCTGGTCATGCTGGCAGGCGAGGGGTGCAGCCAGGCAGCTTA
TTTATAAAGCTAAAGGTTGCTAAAGATCCTCTATTTGCTAGAGAAGGAGCTGACCTTTATGTAGATTATCATATCAGCTTTACAAAAGCT
ATCCTTGGTGGTAAAGTTGAGGTACCAACTCTATCTGGAAAGACAAATATACAGGTACCCAAGGGTGTTCAGCCTGGACAACTTGXTGGT
ACTACGAGGCAAAGGTTTGCCAAAGAGTGGATTTCTGGTGAACCATGGCGATCAATACGTGCGGTTCCTATTGACTTCCCAACAGCATTG
AATGAACGGCAGCGTGCTATAATGGAAGAATTTGCACAGGAGGAAGTTGTTAATGGAGATTACATGGATGGAGAAGTAAATTTGTGGCAG
CAGTTGCTTGAACGCGTATCAAACCCAAAGTTTGTGGTTGAXGTTCTCACTCTTGATAGTGATTCTTCTATTGTTAATCAAAACACTATG
ATTGTGGAGGCGTCAGCTGCCTCGGCAGATACAAGAATCCCTGATCCAGCTGCTTTCAACATCATACCTGCACAGAGTTTGCTATTCTCC
GGCTTCAATCTGACTGGAGAGAACTTCCCAAACATCTACAGTCCTGGTAGCTATATCACATACACATGG
Edits in Original Sequence 
(5')XGGAGCATAAAAAGTGAAACATTTTCGTTTTTCAAGATTGAACCAACAATTaGACAGCAGTAGCTCTAGATTTTCAGTTACAGATT
CTTTTGCAACTCAAAATGGGCAGACTGAGGTGGaCAGGAGTTTCCCCAAAATCTATCATTAAAATTATTTTGTCACAGCACTCAGTTTCT
GCAAATTCGATGATCAATAAAGGGAACGTGTGTACACATGTTTCAGAATATCTACCTACATTACTTAAAAATCGATCTTTGTACAGTTGC
AGTTTTATTGGTAAACCTAATAGTTCTTCGACTAGGAGATTTCCACCGTTGAAGCATTTTTTCCATTCCACCGGAGCTTGTTATTCTGCA
GAACGAGATTACTATGAAATTCTAGGTGTATCTAGAGATTCTACTCGAGATGAGATTAAGAAGGCTTTTCATGTGCTTGCTAAAAAATAC
CACCCAGATGCCAATAAGAATAATCCATCTGCAAAGAGGAAATTTCAAGAGATAAGAGATGCATATGAGATTTTGCAAAACCCACAGAAG
AGAGCACAATATGACATGATGAAGGAGCAACCAAGCAACAACACAGAAAATATAAATTATAATCATAGGAATGGCAATGATTTTAGATAT
ACATATAGCACACAATTCTCTGGTTCGTTTCAGAAAATATTTTCTGAGATATTTGAAAATGAGGCTGAAAATCTGACGCAAGACATTCAG
GTGGAGCTTTCTCTCTCTTTTTCTGAAGCTGCTAAAGGATGCACAAAACATCTTTCATTTGATGCAGATGTACCATGTGATTCTTGCAGT
GGTTTGGGCTATCCATTGAATTCAACTCCAAAAGTATGTCCAACTTGTCAAGGAGTTGGGAGAGTTACAATTCCTCCATTTACAGCAACT
TGCAGTACCTGTAAAGGATCTGGACGAGTCATTAAGGAACGATGTAGGGCATGCAAAGCATCAGGAGTTGTTGAAGCCATTAAAGACGTT
AAAGTAACTATACCTGCCGGTGTTGACTCCGGTGATACTATTCGGGTGCCAAAAGCTGGTCATGCTGGCAGGCGAGGGGTGCAGCCAGGC
AGCTTATTTATAAAGCTAAAGGTTGCTAAAGATCCTCTATTTGCTAGAGAAGGAGCTGACCTTTATGTAGATTATCATATCAGCTTTACA
AAAGCTATCCTTGGTGGTAAAGTTGAGGTACCAACTCTATCTGGAAAGACAAATATACAGGTACCCAAGGGTGTTCAGCCTGGACAACTT
GXTGGTACTACGAGGCAAAGGTTTGCCAAAGAGTGGATTTCTGGTGAACCATGGCGATCAATACGTGCGGTTCCgTATTGACTTCCCAAC
AGCATTGAATGAACGGCAGCGTGCTATAATGGAAGAATTTGCACAGGAGGAAGTTGTTAATGGAGATTACATGGATGGAGAAGTAAATTT
GTGGCAGCAGTTGCTTGAACGCGTATCAAACCCAAAGTTTGTGGTTGAXGTTCTCACTCTTGATAGTGATTCTTCTATTGTTAATCAAAA
CACTATGATTGTGGAGGCGTCAGCTGtCCTCGGCAGATACAAGAATCCCTGATCCAGCTGCTTTCAACATCATACCTGCACAGAGTTTGC
TATTCTCCGGCTTCAATCTGAtCTGGAGAGAACTTCCCAAACATCTACAGTCCTGGTAGCTATATCACATACACATGG(3')TAGAGTCA
TTTTTTATCGTTCACCTTTTGGGTCGAGTTCAGATTATATACTAGCATTTAACATGCCTATATAGTTCTCAAAATAAAAAAGGAAGTGCC
TATTTTATCCAAGGCCTTTTATTAGAAAGTTGAGAGTTTGAGTATATCATAGAAGTATCCCTGTATTTTCTACCTACAAAAATTGTAGAG
AATTACTGATAAGTCTCTGGAATTTTGCATAGTTCCAGTTGTACTCTTTTAACATGTTCTATATATTTTATTTGTTTTTTGGGGACTGAA
AAATATAGTTTTCTTTTTCCGCTTTTCTCTGTAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan