ESTScan Details for Unigene SGN-U571441

Score 
1589
Direction 
Forward
Predicted Peptide Sequence 
XFQEKQWAEDATKSSVPPDEEDDGDDEPQQFAGGNEENEKPNNIEMEILESSTNFQSVTLNSPIQNPTPDHEPNVDIYEVIRASDCGIGX
GIGKFRAKIAEGMVESCVGGLEGSVVGEFSGLIDTTKAKLCFEQFLYSDMIFCGAGMLPRDVHKLHLVDLKGPFVLQVDEIVNISCPLRD
RYQKVAAGIKRCLKLSMTDGIQRVFGMEYRPIKDLDVLAPSGLKVAICNVHVRHGILMLVPEVIEVLGGMVEDLEEARKRLVNEINKPPR
GKRTRSGVVPPLATRAIAAAWPREGVTVPEHSDTSSRQNMQFQVHERGTSGIATTASEEIHPVRSGLPSSTTFITPVYRREAQSNIPSTP
AVSVPFNRNAEPTFSSDAASHAEDIHMADMTTEDIDVAIRREHNDTVLSSLSSMDVEELLSDVRSDPTTPASSRTRGSVCVSSGSFHNED
VTPDTLSTAAIDVDEIDLVDELDHPYILSGAKENPFTYLASLSAKQAGMHGSASTVTGKIKCFLTGVKGFQYKQSSKYELRVYVDDGSLI
SEILIDHALVQEKIGFSPAEVNAALSSSDRKRVSDTKETLKCFQKFLINFEGTMLVHLNEESPIPVATEMNQGCSASDAWLLLKRLKPSL
LRDNIIFITQKP*
Predicted Coding Sequence 
XTTTTTCAGGAAAAACAATGGGCAGAAGACGCCACCAAATCATCTGTTCCTCCXGACGAAGAAGACGACGGCGACGACGAACCTCAGCAA
TTCGCCGGCGGCAATGAAGAAAATGAAAAGCCTAATAACATAGAAATGGAAATTCTAGAATCATCTACTAACTTCCAATCAGTTACCCTA
AATTCTCCCATCCAGAACCCTACACCTGATCATGAGCCAAACGTCGACATTTATGAAGTTATACGAGCTTCGGATTGTGGTATTGGTCXG
GGTATTGGAAAATTTAGGGCTAAGATTGCGGAGGGAATGGTTGAATCATGTGTTGGAGGACTTGAAGGATCAGTAGTAGGAGAGTTTTCT
GGATTGATTGATACGACCAAGGCGAAACTTTGTTTCGAGCAGTTTTTGTACTCGGATATGATTTTTTGTGGTGCAGGAATGCTTCCAAGG
GACGTTCACAAGCTGCATTTGGTTGATCTTAAAGGGCCCTTTGTTCTTCAGGTAGATGAGATTGTGAATATCAGTTGTCCTCTTCGAGAT
AGGTATCAGAAAGTAGCTGCTGGAATAAAGAGGTGTCTGAAATTGTCCATGACTGATGGCATTCAGCGAGTGTTTGGGATGGAGTACAGG
CCTATAAAAGATCTCGATGTTCTAGCTCCTTCTGGACTGAAGGTTGCTATCTGTAATGTTCATGTTAGGCATGGAATTCTGATGTTGGTC
CCTGAAGTTATTGAAGTTCTGGGTGGGATGGTGGAAGACTTAGAAGAAGCAAGGAAGCGGCTAGTTAATGAAATAAATAAGCCACCAAGG
GGGAAAAGAACAAGGTCTGGTGTGGTTCCTCCTTTGGCAACTAGAGCTATAGCTGCTGCATGGCCACGAGAAGGTGTTACTGTTCCAGAG
CACTCTGATACTTCCTCAAGACAAAATATGCAATTTCAGGTTCATGAACGAGGAACATCTGGCATTGCTACTACTGCAAGTGAAGAAATT
CATCCCGTTAGATCTGGGCTACCATCTTCTACGACATTCATCACTCCTGTTTATAGAAGAGAGGCTCAATCTAATATCCCATCTACTCCA
GCTGTTTCTGTCCCATTCAATAGGAACGCTGAACCTACCTTTTCATCTGATGCAGCTAGTCATGCAGAGGATATCCATATGGCTGACATG
ACCACTGAAGACATTGATGTTGCAATTAGAAGGGAACATAATGACACTGTCCTTTCATCTTTGTCTTCCATGGATGTGGAGGAACTTTTG
TCAGATGTTAGAAGTGACCCTACCACACCTGCCAGTAGCAGGACCAGAGGAAGCGTTTGTGTGTCTAGCGGTAGTTTCCATAATGAAGAT
GTAACACCAGATACATTGTCTACTGCAGCAATTGACGTTGATGAAATTGATTTGGTTGATGAATTGGACCATCCATATATACTTTCTGGA
GCAAAGGAAAACCCTTTCACTTACTTAGCTAGTCTGTCAGCTAAGCAGGCTGGTATGCATGGCAGTGCTTCCACTGTTACAGGAAAAATT
AAGTGCTTTCTTACTGGTGTGAAGGGATTTCAGTATAAACAGAGTAGTAAATACGAGCTTCGGGTTTATGTTGATGATGGCAGCCTAATC
TCTGAGATCCTTATAGATCATGCTCTTGTGCAGGAAAAAATAGGCTTTTCTCCTGCAGAGGTAAATGCTGCTCTTAGTTCTTCAGATAGA
AAACGAGTCAGTGACACGAAGGAGACACTGAAATGTTTCCAGAAATTCTTGATTAATTTTGAGGGAACAATGCTTGTTCATTTGAATGAA
GAATCTCCAATTCCAGTTGCTACTGAAATGAACCAGGGGTGCTCTGCCTCTGATGCATGGTTGCTTCTCAAAAGACTAAAGCCTTCACTT
CTCCGCGACAACATCATCTTCATCACTCAGAAACCATAA
Edits in Original Sequence 
(5')XTTTTTCAGGAAAAACAATGGGCAGAAGACGCCACCAAATCATCTGTTCCTCCXGACGAAGAAGACGACGGCGACGACGAACCTCA
GCAATTCGCCGGCGGCAATGAAGAAAATGAAAAGCCTAATAACATAGAAATGGAAATTCTAGAATCATCTACTAACTTCCAATCAGTTAC
CCTAAATTCTCCCATCCAGAACCCTACACCTGATCATGAGCCAAACGTCGACATTTATGAAGTTATACGAGCTTCGGATTGTGGTATTGG
TCXGGGTATTGGAAAATTTAGGGCTAAGATTGCGGAGGGAATGGTTaGAATCATGTGTTGGAGGACTTGAAGGATCAGTAGTAGGAGAGT
TTTCTGGATTGATTGATACGACCAAGGCGAAACTTTGTTTCGAGCAGTTTTTGTACTCGGATATGATTTTTTGTGGTGCAGGAATGCTTC
CAAGGGACGTTCACAAGCTGCATTTGGTTGATCTTAAAGGGCCCTTTGTTCTTCAGGTAGATGAGATTGTGAATATCAGTTGTCCTCTTC
GAGATAGGTATCAGAAAGTAGCTGCTGGAATAAAGAGGTGTCTGAAATTGTCCATGACTGATGGCATTCAGCGAGTGTTTGGGATGGAGT
ACAGGCCTATAAAAGATCTCGATGTTCTAGCTCCTTCTGGACTGAAGGTTGCTATCTGTAATGTTCATGTTAGGCATGGAATTCTGATGT
TGGTCCCTGAAGTTATTGAAGTTCTGGGTGGGATGGTGGAAGACTTAGAAGAAGCAAGGAAGCGGCTAGTTAATGAAATAAATAAGCCAC
CAAGGGGGAAAAGAACAAGGTCTGGTGTGGTTCCTCCTTTGGCAACTAGAGCTATAGCTGCTGCATGGCCACGAGAAGGTGTTACTGTTC
CAGAGCACTCTGATACTTCCTCAAGACAAAATATGCAATTTCAGGTTCATGAACGAGGAACATCTGGCATTGCTACTACTGCAAGTGAAG
AAATTCATCCCGTTAGATCTGGGCTACCATCTTCTACGACATTCATCACTCCTGTTTATAGAAGAGAGGCTCAATCTAATATCCCATCTA
CTCCAGCTGTTTCTGTCCCATTCAATAGGAACGCTGAACCTACCTTTTCATCTGATGCAGCTAGTCATGCAGAGGATATCCATATGGCTG
ACATGACCACTGAAGACATTGATGTTGCAATTAGAAGGGAACATAATGACACTGTCCTTTCATCTTTGTCTTCCATGGATGTGGAGGAAC
TTTTGTCAGATGTTAGAAGTGACCCTACCACACCTGCCAGTAGCAGGACCAGAGGAAGCGTTTGTGTGTCTAGCGGTAGTTTCCATAATG
AAGATGTAACACCAGATACATTGTCTACTGCAGCAATTGACGTTGATGAAATTGATTTGGTTGATGAATTGGACCATCCATATATACTTT
CTGGAGCAAAGGAAAACCCTTTCACTTACTTAGCTAGTCTGTCAGCTAAGCAGGCTGGTATGCATGGCAGTGCTTCCACTGTTACAGGAA
AAATTAAGTGCTTTCTTACTGGTGTGAAGGGATTTCAGTATAAACAGAGTAGTAAATACGAGCTTCGGGTTTATGTTGATGATGGCAGCC
TAATCTCTGAGATCCTTATAGATCATGCTCTTGTGCAGGAAAAAATAGGCTTTTCTCCTGCAGAGGTAAATGCTGCTCTTAGTTCTTCAG
ATAGAAAACGAGTCAGTGACACGAAGGAGACACTGAAATGTTTCCAGAAATTCTTGATTAATTTTGAGGGAACAATGCTTGTTCATTTGA
ATGAAGAATCTCCAATTCCAGTTGCTACTGAAATGAACCAGGGGTGCTCTGCCTCTGATGCATGGTTGCTTCTCAAAAGACTAAAGCCTT
CtACTTCTCCGCGACAACATCATCTTCATCACTCAGAAACCATAA(3')ATTTATCCCCTTGATGTGTCGTTGGTTCATGGGGAATTTGA
TAACCACGAGAGCAAGGTGAATTAGAGTGACATTGCTCAATTTAGGAAGTTGTTGCATGAGATGACGCCCAGAAGCAATGGCGTAAATGC
AGAAATAGTTCACCTGTGATTCAAACAATGAAAGGACTTGTCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan