ESTScan Details for Unigene SGN-U571555

Score 
1540
Direction 
Forward
Predicted Peptide Sequence 
XTNKAVIAPSSSTIPIPYVSSGVGVTHIHXPNGESNYQNRLRHWLFVYIEKPYTKVIIFFVFTSTLTVDTADSRIALFLLSEAMALKIKS
RLVDQPPSASSSEDQELVEESHEEEQQQSGEGEGEEESGEETEEPKTAHPVVKRFLTQKLQLSSESGSENGSGSESEAESGHSLPSPSAS
DFTVKPSVPAKAAAPSKSVAKRPQKAQKEKGRKKPKIAEEEEKKSAATPRFLWSDDDQLALLKGIVEYKEVEGMEPNADMSAFHEFIKGK
LQVEVSKSQLSEKLKRLKKKFLTNVKGGEEPVFMKDQDFSVFQHSKRIWGAPGTSNGVKEILTNSTNGKAKKAVEIKKSSEPKESAKVSK
PKDDEKHKEVEEQVAVKEVVREDIVKDDHQDFQSEYPRLAASFESMAGMSAMYPNGSSFLKEKLSLIATDKAKELEEKWKKLEDDEAALM
VKRLDFIAERYKLVVDAMRGN*
Predicted Coding Sequence 
XXCACAAATAAAGCXGTGATTGCTCCATCATCTTCCACCATCCCGATTCCTTATGTGAGTAGTGGTGTTGGTGTAACTCACATACATGXT
CCAAATGGGGAAAGTAATTATCAAAATCGATTAAGACATTGGCTTTTTGTATATATCGAAAAACCCTACACTAAAGTTATCATCTTTTTT
GTCTTTACTTCAACACTAACCGTAGACACAGCTGACAGCCGAATAGCTCTCTTCTTGCTTTCAGAAGCAATGGCCCTCAAAATCAAATCC
CGCTTAGTAGACCAGCCTCCTTCTGCATCGTCCTCTGAAGATCAAGAACTGGTGGAGGAATCCCATGAAGAAGAACAACAACAATCGGGG
GAGGGGGAAGGAGAAGAAGAATCAGGGGAAGAAACTGAAGAACCCAAGACAGCTCATCCAGTTGTAAAGAGATTCCTCACTCAGAAACTC
CAACTTTCTTCTGAGTCCGGCAGCGAGAATGGGTCAGGATCCGAATCGGAAGCCGAATCGGGCCATTCCCTGCCTTCCCCTTCTGCATCG
GACTTCACCGTCAAGCCCAGTGTTCCTGCTAAAGCTGCTGCCCCATCGAAATCAGTAGCAAAGAGGCCGCAAAAGGCCCAGAAAGAAAAA
GGGAGGAAGAAGCCCAAGATTGCAGAAGAAGAGGAGAAAAAATCAGCTGCTACTCCTCGATTTCTTTGGAGCGATGACGACCAGCTTGCT
CTGCTCAAAGGGATTGTTGAATACAAGGAGGTAGAAGGAATGGAACCTAATGCCGATATGTCTGCGTTTCATGAATTCATCAAAGGGAAG
TTGCAGGTTGAAGTTTCAAAGAGTCAACTCAGTGAAAAGCTAAAGAGGTTAAAGAAGAAATTTTTAACTAATGTGAAAGGTGGTGAGGAG
CCAGTTTTCATGAAGGATCAGGATTTTTCAGTTTTTCAGCATTCAAAGAGGATTTGGGGTGCCCCTGGAACAAGTAATGGAGTTAAGGAG
ATTCTTACCAATAGCACTAATGGCAAAGCTAAAAAGGCTGTTGAGATTAAGAAGAGTTCTGAACCTAAGGAAAGTGCTAAAGTTAGCAAA
CCCAAGGATGATGAGAAACATAAGGAAGTAGAGGAACAGGTTGCTGTAAAAGAGGTGGTTAGGGAGGATATAGTTAAGGATGATCACCAG
GATTTCCAGTCCGAATATCCAAGATTGGCTGCATCATTTGAAAGTATGGCTGGCATGTCTGCAATGTATCCAAATGGTTCAAGTTTTTTG
AAGGAGAAGTTGAGTTTGATTGCTACTGACAAGGCTAAAGAGTTGGAGGAGAAGTGGAAGAAACTGGAGGATGATGAAGCTGCCTTGATG
GTGAAGCGCTTAGATTTCATTGCAGAGCGTTACAAATTGGTGGTTGATGCAATGAGAGGTAACTAG
Edits in Original Sequence 
(5')XXCACAAATAAAGCXGTGATTGCTCCATCATCTTCCgACCATCCCGATTCCTTATGTGAGTAGTGGTGTTGGTGTAACTCACATAC
ATGXTCCAAATGGGGAAAGTAATTATCAAAATCGATTAAGACATTGGCTTTTTGTATATATCGAAAAACCCTACACTAAAGTTATCATCT
TTTTTGTCTTTACTTCAACACTAACCGTAGACACAGCTGACAGCCGAATAGCTCTCTTCTTGCTTTCAGAAGCAATGGCCCTCAAAATCA
AATCCCGCTTAGTAGACCAGCCTCCTTCTGCATCGTCCTCTGAAGATCAAGAACTGGTGGAGGAATCCCATGAAGAAGAACAACAACAAT
CGGGGGAGGGGGAAGGAGAAGAAGAATCAGGGGAAGAAACTGAAGAACCCAAGACAGCTCATCCAGTTGTAAAGAGATTCCTCACTCAGA
AACTCCAACTTTCTTCTGAGTCCGGCAGCGAGAATGGGTCAGGATCCGAATCGGAAGCCGAATCGGGCCATTCCCTGCCTTCCCCTTCTG
CATCGGACTTCACCGTCAAGCCCAGTGTTCCTGCTAAAGCTGCTGCCCCATCGAAATCAGTAGCAAAGAGGCCGCAAAAGGCCCAGAAAG
AAAAAGGGAGGAAGAAGCCCAAGATTGCAGAAGAAGAGGAGAAAAAATCAGCTGCTACTCCTCGATTTCTTTGGAGCGATGACGACCAGC
TTGCTCTGCTCAAAGGGATTGTTGAATACAAGGAGGTAGAAGGAATGGAACCTAATGCCGATATGTCTGCGTTTCATGAATTCATCAAAG
GGAAGTTGCAGGTTGAAGTTTCAAAGAGTCAACTCAGTGAAAAGCTAAAGAGGTTAAAGAAGAAATTTTTAACTAATGTGAAAGGTGGTG
AGGAGCCAGTTTTCATGAAGGATCAGGATTTTTCAGTTTTTCAGCATTCAAAGAGGATTTGGGGTGCCCCTGGAACAAGTAATGGAGTTA
AGGAGATTCTTACCAATAGCACTAATGGCAAAGCTAAAAAGGCTGTTGAGATTAAGAAGAGTTCTGAACCTAAGGAAAGTGCTAAAGTTA
GCAAACCCAAGGATGATGAGAAACATAAGGAAGTAGAGGAACAGGTTGCTGTAAAAGAGGTGGTTAGGGAGGATATAGTTAAGGATGATC
ACCAGGATTTCCAGTCCGAATATCCAAGATTGGCTGCATCATTTGAAAGTATGGCTGGCATGTCTGCAATGTATCCAAATGGTTCAAGTT
TTTTGAAGGAGAAGTTGAGTTTGATTGCTACTGACAAGGCTAAAGAGTTGGAGGAGAAGTGGAAGAAACTGGAGGATGATGAAGCTGCCT
TGATGGTGAAGCGCTTAGATTTCATTGCAGAGCGTTACAAATTGGTGGTTGATGCAATGAGAGGTAACTAG(3')ATGCTGGTGGATCAT
GTTTTTATTGGATGCTATAAGTTTTGATACTGTTTCGGTTGAGTTTTGCGTTTTGTTTCATATAGTCTTGTTTCTCAAGACAATTTCTTC
TCGCGTTGATGTACTTATGTTTAGTCCGCGAGGTAGATTTAGTTTTTCAGGTTAATTCATACATTTTTATTGCTTATCTAGTTTTACTAG
TGAACTGGTTTGGATGATATCTGCTGTGTTGCTTCTTTTTTATGTTAGTGTGGTATGGAGTGATTGGCTCTATTTAGGGATTGCAGTGAA
AGGCCTACACATTCCTATCATTCAATGCCATGCATGGTGGAAGCAAGCTTAGGAACAGCTGAAGTGGAATGTCTGGAGACGTTCTGGTTC
ATCCTTTGTAATATGTTATTTCCTATTCGAGATGGAAATATATTTAAATGCGATCTTTCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan