ESTScan Details for Unigene SGN-U571571

Score 
561
Direction 
Forward
Predicted Peptide Sequence 
EGLTLLNNNGGNNMDDCEHNRESEVAPALIAVHPTQKSVAVAVGSNLRVFNLQEGCSVSLVDNSGVHMHKDSIRAIQYGAEGKLFVSAGD
DKLVKIWVTDSWRCISSVSSEKRVTAVAISNDGRFVSFADKFGVIYAVEIEGSHENQSVPNKKAVPILAHYCSIITSLEFSPDGRYIISA
DRDFKIRVSVFPEKPSDGAHEIQSFCLGHSEFVSCLAFICNQDSQQWYLLSGGGDSTVRLWDFTCGSLLDTCHVGEDYYSQKKEXDDRLL
AVTDLCATPWGSLIAVAIQSLAGVMLLSCNPSAKSL
Predicted Coding Sequence 
GAAGGTTTAACTCTACTCAACAACAATGGAGGAAACAACATGGATGATTGTGAACACAACCGTGAATCTGAGGTTGCTCCGGCGTTAATT
GCAGTTCATCCAACTCAGAAATCCGTCGCCGTTGCCGTCGGTTCGAATCTCCGCGTCTTTAATCTTCAAGAAGGTTGTTCGGTTTCATTG
GTGGATAATTCAGGAGTGCACATGCATAAGGATTCAATAAGAGCAATTCAATATGGTGCTGAAGGAAAGCTGTTTGTATCTGCTGGCGAT
GACAAACTTGTTAAGATTTGGGTTACTGATTCTTGGCGGTGCATAAGTTCGGTGTCATCCGAGAAGAGAGTTACTGCTGTTGCCATCAGT
AATGATGGGCGTTTTGTATCCTTCGCGGATAAATTTGGTGTAATTTATGCAGTTGAAATAGAAGGTTCTCATGAAAATCAAAGTGTGCCC
AATAAGAAGGCAGTCCCAATTCTCGCCCACTACTGCAGCATCATTACTAGTCTGGAGTTTTCACCAGATGGACGTTACATTATTAGTGCC
GATCGGGACTTCAAAATCCGAGTCTCTGTGTTCCCAGAAAAGCCATCAGATGGGGCTCATGAGATTCAAAGTTTTTGCCTTGGCCATTCA
GAGTTTGTTTCCTGCCTTGCCTTCATCTGCAACCAGGATTCCCAGCAGTGGTATTTGCTTTCAGGAGGTGGTGATTCAACTGTACGCTTG
TGGGACTTCACTTGTGGTTCTCTTCTTGATACCTGTCATGTTGGAGAGGACTATTACAGTCAAAAGAAGGAAXTAGATGACAGGTTGCTG
GCTGTCACTGATCTTTGTGCCACTCCTTGGGGATCTCTAATCGCGGTGGCTATTCAGAGCTTGGCAGGCGTCATGCTTTTGAGTTGCAAC
CCTTCAGCTAAATCTCTX
Edits in Original Sequence 
(5')GAAGGTTTAACTCTACTCAACAACAATGGAGGAAACtAACATGGATGATTGTGAACACAACCGTGAATCTGAGGTTGCTCCGGCGT
TAATTGCAGTTCATCCAACTCAGAAATCCGTCGCCGTTGCCGTCGGTTCGAATCTCCGCGTCTTTAATCTTCAAGAAGGTTGTTCGGTTT
CATTGGTGGATAATTCAGGAGTGCACATGCATAAGGATTCAATAAGAGCAATTCAATATGGTGCTGAAGGAAAGCTGTTTGTATCTGCTG
GCGATGACAAACTTGTTAAGATTTGGGTTACTGATTCTTGGCGGTGCATAAGTTCGGTGTCATCCGAGAAGAGAGTTACTGCTGTTGCCA
TCAGTAATGATGGGCGTTTTGTATCCTTCGCGGATAAATTTGGTGTAATTTATGCAGTTGAAATAGAAGGTTCTCATGAAAATCAAAGTG
TGCCCAATAAGAAGGCAGTCCCAATTCTCGCCCACTACTGCAGCATCATTACTAGTCTGGAGTTTTCACCAGATGGACGTTACATTATTA
GTGCCGATCGGGACTTCAAAATCCGAGTCTCTGTGTTCCCAGAAAAGCCATCAGATGGGGCTCATGAGATTCAAAGTTTTTGCCTTGGCC
ATTCAGAGTTTGTTTCCTGCCTTGCCTTCATCTGCAACCAGGATTCCCAGCAGTGGTATTTGCTTTCAGGAGGTGGTGATTCAACTGTAC
GCTTGTGGGACTTCACTTGTGGTTCTCTTCTTGATACCTGTCATGTTGGAGAGGACTATTACAGTCAAAAGAAGGAAXTAGATGACAGGT
TGCTGGCTGTCACTGATCTTTGTGCCACTCCTTGGGGATCTCTAATCGCGGTGGCTATTCAGAGCTTGGCAGGCGTCATGCTTTTGAGTT
GCAACCCTTCAGCTAAATCTCTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan