Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U571922

Score 
519
Direction 
Forward
Predicted Peptide Sequence 
XCIAEEEMKVAPKVILLFRDPTGFGTAIFEALQPNPKSNLQKRQESLDLSLQHYGIKDQKVSVEVVHFLNGANLEVSLLLLENYEPPTLA
CALNEVLALLVGDGLSNMPTIVAPFVVAASKLKMENRTSVSIDNRSVYGLQVGASSDLTKALCTNLQSPPPSLQICNEQLACLLQLVRVL
KMPTYVIIGKKGQNLHRKTSEEEHEVIHEIGQHLASFSSLSFSGEKIAWDATKSSKETQEPWRAXIWLNLNAGHNQRLTWRRVIDXQYAP
KVGVPADVWVSTIGVWCMNPERRQYFLEADEDANVKLLCSILNFLSCIPWHLLLNQKNPDVFLILVKYKPYNS*
Predicted Coding Sequence 
XATTGCATTGCAGAAGAAGAAATGAAGGTAGCCCCAAAAGTAATACTACTCTTCAGAGATCCAACTGGCTTCGGCACCGCCATCTTCGAA
GCTCTTCAACCAAACCCTAAATCCAACCTTCAAAAGCGACAAGAATCGCTCGATTTATCCTTACAACATTACGGAATTAAAGATCAAAAG
GTTTCGGTTGAAGTCGTTCATTTTCTCAATGGAGCAAATCTCGAGGTGTCTCTGTTACTACTGGAAAACTATGAGCCTCCAACACTTGCT
TGTGCACTCAATGAAGTTCTGGCTTTGTTAGTAGGAGATGGGTTGTCAAATATGCCCACAATTGTAGCCCCTTTTGTTGTGGCTGCATCT
AAGCTTAAGATGGAAAATAGAACTTCTGTTTCAATTGACAATAGATCAGTTTATGGGTTGCAAGTAGGTGCCTCTAGTGACCTTACTAAA
GCTTTGTGCACAAATTTGCAAAGCCCTCCCCCATCGTTGCAGATTTGTAACGAACAGTTGGCCTGCCTACTTCAATTGGTTCGAGTCCTG
AAGATGCCTACTTATGTTATAATTGGCAAAAAAGGTCAAAATTTGCATCGTAAGACTTCGGAAGAGGAACACGAGGTGATACATGAGATA
GGACAGCATTTGGCTAGCTTCTCATCTCTTAGTTTTTCAGGAGAAAAGATAGCCTGGGATGCAACAAAGTCTTCGAAAGAAACTCAAGAG
CCTTGGCGTGCATTXATATGGTTGAATCTTAATGCTGGCCATAATCAGCGTCTAACATGGCGTCGTGTTATTGATXTTCAGTATGCTCCT
AAGGTAGGAGTTCCAGCAGATGTGTGGGTAAGCACAATTGGTGTGTGGTGTATGAACCCAGAGAGACGCCAATATTTCCTCGAGGCAGAC
GAAGACGCCAATGTAAAGCTTCTTTGTTCCATTCTCAATTTTCTTTCTTGTATCCCATGGCATCTGTTGCTTAACCAGAAAAATCCTGAT
GTTTTTTTAATATTAGTCAAATATAAACCATACAACTCTTAA
Edits in Original Sequence 
(5')XATTGCATTGCAGAAGAAGAAATGAAGGTAGCCCCAAAAGTAATACTACTCTTCAGAGATCCAACTGGCTTCGGCACCGCCATCTT
CGAAGCTCTTCAACCAAACCCTAAATCCAACCTTCAAAAGCGACAAGAATCGCTCGATTTATCCTTACAACATTACGGAATTAAAGATCA
AAAGGTTTCGGTTGAAGTCGTTCATTTTCTCAATGGAGCAAATCTCGAGGTGTCTCTGTTACTACTGGAAAACTATGAGCCTCCAACACT
TGCTTGTGCACTCAATGAAGTTCTGGCTTTGTTAGTAGGAGATGGGTTGTCAAATATGCCCACAATTGTAGCCCCTTTTGTTGTGGCTGC
ATCTAAGCTTAAGATGGAAAATAGAACTTCTGTTTCAATTGACAATAGATCAGTTTATGGGTTGCAAGTAGGTGCCTCTAGTGACCTTAC
TAAAGCTTTGTGCACAAATTTGCAAAGCCCTCCCCCATCGTTGCAGATTTGTAACGAACAGTTGGCCTGCCTACTTCAATTGGTTCGAGT
CCTGAAGATGCCTACTTATGTTATAATTGGCAAAAAAGGTCAAAATTTGCATCGTAAGACTTCGGAAGAGGAACACGAGGTGATACATGA
GATAGGACAGCATTTGGCTAGCTTCTCATCTCTTAGTTTTTCAGGAGAAAAGATAGCCTGGGATGCAACAAAGTCTTCGAAAGAAACTCA
AGAGCCTTGGCGTGCATTXATATGGTTGAATCTTAATGCTGGCCATAATCAGCGTCTAACATGGCGTCGTGTTATTGATXTTCAGTATGC
TCCTAAGGTAGGAGTTCCAGCAGATGTGTGGGTAAGCACAATTGGTGTGTGGTGTATGAACCCAGAGAGACGCCAATATTTCCTCGAGGC
AGACGAAGACGCCAATGTAAAGCTTCTTTGTTCCATTCTCAATTTTCTTTCTTGTATCCCATGGCATCTGTTGCTTAACCAGAAAAATCC
TcGATGTTTTTTTAATATTAGTCAAATATAAACCATACAACTCTTAA(3')TTATTCTTATTAACCTTTATATTATATAAATAGAGACCA
TATATATACGATCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan