ESTScan Details for Unigene SGN-U571931

Score 
1631
Direction 
Forward
Predicted Peptide Sequence 
MAFLPCPLRYSKMNSLFLLRKSSSSLTSKRVSINSISHIFSDKFSPRNALRLPQVQSFTTSLTVSAPPMNRVDGKFGYSVKGFHGGGCCL
QAATATAMAMVELEEDCEEGLEISKLGISEEIVSALAQRGITSLFPIQRAVLEPAMQGSDMIGRARTGTGKTLAFGIPIMDKIIRFNRKK
GRGRNPLALILAPTRELARQVDKEFYESAPILDTLCVYGGVPISRQMSTLDRGTDIVVGTPGRIIDLLKRGSLNLSDIQFVVLDEADQML
NVGFAEDVETILENIXAETSDNDVFSHDAKLDIETYQEVLEETNSLDLVGDSDQKLADGISLYSIACEMRQKPAVLGPLISEHAKGGKCI
VFTQTKRDADRLAGAMQRTLRCEALHGDISQSQRERTLSGFRQGQFNVLVATDVAARGLDVPNVDLVIHYELPNNSEIFVHRSGRTGRAG
KKGSAILMHSSKQHRDVKGIEHDAGCRFTELPTIKVEAGAVEMYSEMGKDVGRFGSSGGGTMRSRSSDFGGGRSGGYGNKSSKFGREVSS
SSVRTGGYSATGSGRSRGGFSGASSGRSGKFGGGSGDTRGSKRLGGFRNFGGFGSSKSSNRSNNFAEEFDSGRSRRFGDSDHDRNNRSSR
FDVFGDDNEVVNGDQSWRRTISNSVARRCGHSIDDGEDETPICEVCMFITRCCRVAAAADGDARLVTVENNTSTSTWSPKVPTXLYVTDS
YQVLTIAGRYVSSLYA*
Predicted Coding Sequence 
ATGGCTTTTCTCCCTTGTCCATTGAGATATAGCAAAATGAACAGTCTTTTTCTACTGAGGAAGTCTTCATCTTCACTAACATCAAAAAGG
GTGTCCATTAATTCCATTTCTCATATCTTCAGTGACAAATTTAGTCCCAGAAATGCCCTTCGATTACCTCAAGTTCAAAGCTTTACCACT
TCTTTAACAGTATCAGCACCACCAATGAACAGGGTTGATGGTAAATTTGGGTATAGTGTTAAGGGATTTCATGGGGGTGGTTGTTGTTTG
CAGGCTGCAACAGCGACGGCAATGGCGATGGTGGAATTAGAAGAGGATTGTGAAGAAGGGCTTGAGATTTCGAAACTTGGGATTTCTGAG
GAAATTGTTTCAGCTTTGGCACAAAGGGGGATTACTAGTCTTTTTCCAATTCAGAGAGCTGTTTTGGAACCAGCAATGCAGGGGTCAGAC
ATGATTGGCCGAGCTAGAACTGGAACTGGAAAGACACTTGCTTTTGGCATTCCTATCATGGATAAGATCATTCGCTTCAACAGAAAAAAG
GGACGGGGAAGAAACCCTTTAGCATTGATCTTGGCTCCCACTAGAGAACTTGCGCGCCAGGTGGACAAGGAATTTTATGAGTCTGCTCCT
ATTCTGGATACTCTGTGTGTTTATGGTGGGGTTCCCATTTCACGCCAAATGAGTACTCTTGACAGGGGAACAGACATTGTTGTCGGGACA
CCTGGTCGTATCATTGATTTGCTGAAGAGAGGGTCATTAAATTTATCAGATATCCAGTTTGTTGTTCTAGATGAAGCTGATCAGATGCTT
AATGTGGGGTTCGCAGAGGATGTTGAAACCATTCTAGAAAATATTAXGGCAGAAACATCAGACAATGATGTTTTCAGCCACGATGCCAAG
TTGGATATTGAAACTTACCAAGAAGTTCTTGAAGAAACCAATTCACTTGATCTTGTAGGAGACTCTGACCAGAAATTAGCTGATGGCATT
TCTTTGTATTCAATTGCTTGTGAGATGCGTCAGAAACCGGCAGTTCTTGGACCCTTAATATCGGAGCATGCAAAAGGAGGCAAATGTATT
GTCTTCACTCAAACAAAGCGTGATGCTGATAGGCTGGCAGGTGCAATGCAAAGAACTTTGAGGTGTGAAGCTTTGCATGGAGATATCTCA
CAAAGCCAGAGGGAGAGAACTCTATCTGGTTTCCGACAAGGTCAATTTAATGTATTGGTGGCCACCGATGTTGCTGCCCGAGGACTTGAT
GTACCTAATGTTGATCTGGTGATACATTACGAACTTCCGAATAATTCAGAGATCTTTGTTCATCGATCTGGTCGAACTGGACGTGCTGGT
AAGAAAGGAAGTGCCATTCTCATGCATTCCTCAAAACAGCATAGGGATGTAAAAGGTATTGAACATGATGCCGGATGCAGATTTACAGAG
CTCCCAACAATTAAAGTAGAGGCTGGAGCAGTAGAAATGTATAGTGAAATGGGAAAAGATGTTGGCCGCTTTGGTTCCTCTGGAGGAGGC
ACTATGCGTAGTCGATCTAGTGATTTTGGTGGAGGCCGTTCTGGTGGCTATGGAAATAAGAGCAGCAAGTTTGGTCGAGAAGTCTCTTCA
TCTTCTGTTCGAACAGGTGGATATAGCGCAACTGGTTCAGGAAGATCAAGAGGTGGCTTTAGCGGAGCTAGCTCAGGCCGCTCAGGAAAG
TTTGGTGGTGGTTCAGGAGACACACGAGGCTCAAAACGTTTGGGTGGTTTCCGCAACTTTGGTGGTTTTGGAAGCTCCAAAAGTTCAAAT
CGATCGAATAATTTTGCAGAAGAGTTTGATTCAGGCCGTTCTAGAAGATTCGGAGATTCAGATCATGATCGAAACAACCGTTCAAGCCGT
TTTGATGTCTTCGGAGATGACAATGAAGTGGTGAATGGTGATCAGAGTTGGAGGAGAACTATTTCTAACTCTGTTGCAAGGAGGTGTGGC
CACTCAATAGATGATGGTGAAGATGAAACTCCGATATGTGAAGTGTGTATGTTTATTACCAGGTGCTGTAGAGTAGCAGCAGCTGCAGAT
GGTGATGCTCGACTCGTTACAGTAGAAAATAACACTTCAACATCCACTTGGTCTCCAAAGGTACCTACACXGCTATATGTAACCGATAGC
TACCAAGTTCTCACCATTGCTGGXCGTTATGTTTCTTCGCTGTATGCTTGA
Edits in Original Sequence 
GGATTTGGTTTTTGAGTGTTTCTTGAAAACCTTATCTCTTCAACACTCCCTCAAATTCTTCCTTCCTTCCTCTGCATAAACCCTAACAAA
AACCCTAGCAAAACA
(5')ATGGCTTTTCTCCCTTGTCCATTGAGATATAGCAAAATGAACAGTCTTTTTCTACTGAGGAAGTCTTCATC
TTCACTAACATCAAAAAGGGTGTCCATTAATTCCATTTCTCATATCTTCAGTGACAAATTTAGTCCCAGAAATGCCCTTCGATTACCTCA
AGTTCAAAGCTTTACCACTTCTTTAACAGTATCAGCACCACCAATGAACAGGGTTGATGGTAAATTTGGGTATAGTGTTAAGGGATTTCA
TGGGGGTGGTTGTTGTTTGCAGGCTGCAACAGCGACGGCAATGGCGATGGTGGAATTAGAAGAGGATTGTGAAGAAGGGCTTGAGATTTC
GAAACTTGGGATTTCTGAGGAAATTGTTTCAGCTTTGGCACAAAGGGGGATTACTAGTCTTTTTCCAATTCAGAGAGCTGTTTTGGAACC
AGCAATGCAGGGGTCAGACATGATTGGCCGAGCTAGAACTGGAACTGGAAAGACACTTGCTTTTGGCATTCCTATCATGGATAAGATCAT
TCGCTTCAACAGAAAAAAGGGACGGGGAAGAAACCCTTTAGCATTGATCTTGGCTCCCACTAGAGAACTTGCGCGCCAGGTGGACAAGGA
ATTTTATGAGTCTGCTCCTATTCTGGATACTCTGTGTGTTTATGGTGGGGTTCCCATTTCACGCCAAATGAGTACTCTTGACAGGGGAAC
AGACATTGTTGTCGGGACACCTGGTCGTATCATTGATTTGCTGAAGAGAGGGTCATTAAATTTATCAGATATCCAGTTTGTTGTTCTAGA
TGAAGCTGATCAGATGCTTAATGTGGGGTTCGCAGAGGATGTTGAAACCATTCTAGAAAATATTAXGGCAGAAACATCAGACAATGATGT
TTTCAGCCACGATGCCAAGTTGGATATTGAAACTTACCAAGAAGTTCTTGAAGAAACCAATTCACgTTGATCTTGTAGGAGACTCTGACC
AGAAATTAGCTGATGGCATTTCTTTGTATTCAATTGCTTGTGAGATGCGTCAGAAACCGGCAGTTCTTGGACCCTTAATATCGGAGCATG
CAAAAGGAGGCAAATGTATTGTCTTCACTCAAACAAAGCGTGATGCTGATAGGCTGGCAGGTGCAATGCAAAGAACTTTGAGGTGTGAAG
CTTTGCATGGAGATATCTCACAAAGCCAGAGGGAGAGAACTCTATCTGGTTTCCGACAAGGTCAATTTAATGTATTGGTGGCCACCGATG
TTGCTGCCCGAGGACTTGATGTACCTAATGTTGATCTGGTGATACATTACGAACTTCCGAATAATTCAGAGATCTTTGTTCATCGATCTG
GTCGAACTGGACGTGCTGGTAAGAAAGGAAGTGCCATTCTCATGCATTCCTCAAAACAGCATAGGGATGTAAAAGGTATTGAACATGATG
CCGGATGCAGATTTACAGAGCTCCCAACAATTAAAGTAGAGGCTGGAGCAGTAGAAATGTATAGTGAAATGGGAAAAGATGTTGGCCGCT
TTGGTTCCTCTGGAGGAGGCACTATGCGTAGTCGATCTAGTGATTTTGGTGGAGGCCGTTCTGGTGGCTATGGAAATAAGAGCAGCAAGT
TTGGTCGAGAAGTCTCTTCATCTTCTGTTCGAACAGGTGGATATAGCGCAACTGGTTCAGGAAGATCAAGAGGTGGCTTTAGCGGAGCTA
GCTCAGGCCGCTCAGGAAAGTTTGGTGGTGGTTCAGGAGACACACGAGGCTCAAAACGTTTGGGTGGTTTCCGCAACTTTGGTGGTTTTG
GAAGCTCCAAAAGTTCAAATCGATCGAATAATTTTGCAGAAGAGTTTGATTCAGGCCGTTCTAGAAGATTCGGAGATTCAGATCATGATC
GAAACAACCGTTCAAGCCGTTTTGATGTCTTCGGAGATGACAATGAtAGTGGTGAATGGTGATCAGAGTTGGAGGAGAACTATTTCTAAC
TCTGTTGCAAGGAGGTGTGGCCACTCAATAGATGATGGTGAAGATGAAACTCCGATATGTGAAGTGTGTATGTTTATTACCAGGTGCTGT
AGAGTAGCAGCAGCTGCAGATGGTGATGCTaCGACTCGTTACAGTAGAAAATAACACTTCAACATCCACTTGGTCTCCAAAGGTACCTAC
ACXGCTATATGTAACCGATAGCTACCAAGTTCTCACCATTGCTGGXCGTTATGTTTCTTCGCTGTATGCTTGA(3')AATAAATATTTTT
TTTGCAAGAGATCATATTGGTACTTGCTAGTGATAGTGGTTGTAATGTTCAAGAGATCATATTGGTACTTGCTAGTGATAGTGGTTGTAA
TGTTCAGTATAAATTTTGAACAGACCTTGATCTTATTATTTAACCAGTTTATGAGGATGTATTCAATTTGTTGAATCAAACAGGTGAAAA
GGCTTATATTGAAAGTACATTGTTTTTCTTTCGCACTTGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan