ESTScan Details for Unigene SGN-U572167

Score 
2930
Direction 
Forward
Predicted Peptide Sequence 
MGKSIKKSATKADAAVVAPTKSMKKGKREAEDEIAKLVSAKKQKKDVAVAQAVEKKKSDLKTQKKKKPVSSSSDDSSSESESEDDKPLVP
PKKVAPAKKGKVASSSDDSDSSDEDEAPAKKVVVASTKNGVAAKKKDESSDDSDDSSSEEDVPAPKKPPTNGAKKDKSSDDSDDSSSEDD
AVVKKAPAVVKKAPAAASKKQESSSDSSDDSSSDDDDEPPSKVVAQPKKAPQAVKKTGDSSDDSDDSESDSDSDKGKAATVAKKTAAVSK
KVASSDDDSEDDSSEESDEEPQKKKSKPSTTPAVSKAPEKSSSEESSDSDDSSEDEEDDKPSKTPKKGADVEMVDAPSAKAQQTPITPKA
QTPGGSKTLFVGNLSYSVEQADVENFFKDAGEVQEVRFATHEDGSFKGFGHVEFVTAEAAHKALELNGHDLLGRDVRLDLARERGEYTPR
SGNENSFQRPARSEGTTIFVRGFDKNEAEDQIRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDADALNKALELDGSEVGGFS
LNVQEAKPRGDSAGGGGRGFGGRSGGRGGGRDSGGRFGGRGGGGRFGGGGPLVAVDXGGGGGRFGGGGRGRGNANKPSFTPSGKKTTFSD
ENLVAIGQLI*
Predicted Coding Sequence 
ATGGGTAAATCTATCAAGAAGTCCGCCACCAAGGCTGATGCTGCTGTAGTTGCTCCAACCAAATCCATGAAGAAAGGGAAGAGAGAAGCT
GAGGATGAAATTGCCAAGTTGGTGAGTGCAAAGAAGCAGAAGAAAGATGTGGCTGTAGCACAAGCTGTTGAGAAAAAGAAAAGTGATCTC
AAAACTCAGAAGAAGAAGAAGCCAGTAAGCAGTTCCTCTGACGATAGCTCCTCTGAGTCGGAGTCTGAGGACGACAAGCCACTGGTGCCT
CCTAAGAAAGTGGCTCCTGCCAAAAAGGGAAAGGTAGCCAGCAGTTCTGATGACTCAGATTCTTCAGATGAGGATGAAGCTCCTGCTAAG
AAAGTTGTTGTAGCTTCAACTAAGAATGGCGTTGCTGCTAAGAAGAAAGATGAGTCAAGTGATGATTCGGATGATAGCAGCTCTGAGGAA
GATGTGCCTGCACCCAAGAAACCTCCTACTAATGGCGCTAAGAAAGACAAGTCAAGTGATGATTCTGATGATAGCAGCTCTGAGGATGAT
GCTGTTGTTAAGAAGGCACCTGCTGTTGTTAAGAAGGCGCCTGCTGCTGCCTCTAAAAAGCAAGAATCCAGCTCTGATTCCAGTGATGAC
TCCAGTTCAGATGATGATGATGAACCTCCCTCTAAGGTAGTTGCTCAACCTAAAAAGGCTCCTCAAGCTGTGAAGAAGACTGGTGACAGC
TCTGATGACTCTGATGATTCTGAATCTGATTCTGATTCAGACAAGGGAAAGGCTGCTACTGTAGCTAAAAAGACTGCTGCTGTATCTAAA
AAGGTTGCTTCATCTGATGATGACAGTGAGGATGATAGTTCCGAGGAGAGTGATGAAGAGCCTCAAAAGAAAAAGAGCAAGCCCTCGACC
ACACCAGCCGTCTCAAAAGCTCCAGAAAAGAGTAGCTCTGAGGAATCTTCTGACTCAGACGACTCCTCTGAAGATGAAGAGGATGACAAA
CCATCCAAAACTCCCAAGAAGGGTGCTGATGTAGAAATGGTTGATGCTCCTTCTGCTAAAGCTCAACAAACCCCTATTACTCCTAAAGCC
CAAACCCCAGGGGGATCGAAAACATTGTTTGTTGGAAATCTATCCTATTCAGTGGAACAGGCGGATGTGGAGAATTTCTTCAAAGATGCT
GGAGAAGTTCAGGAAGTGCGCTTTGCTACACATGAGGATGGTTCATTTAAGGGCTTTGGTCATGTTGAGTTTGTTACTGCTGAAGCTGCG
CATAAGGCACTTGAACTTAATGGGCATGATCTTTTGGGCCGTGATGTGAGGTTGGACCTGGCTCGTGAGAGGGGAGAGTATACACCTCGC
AGTGGGAATGAGAACTCATTCCAGAGGCCGGCTAGAAGTGAGGGAACAACAATTTTTGTCAGGGGCTTTGACAAAAATGAGGCTGAAGAT
CAGATTAGGAGTTCACTGGAGGAGCACTTTGCATCTTGTGGGAAGATCTTTAAAACAAGAATTCCTACAGACCCAGAAGGCTATATTAAA
GGGATGGCTTATATTGAGTTTGCAAATGGAGATGCTGATGCTCTAAACAAAGCTCTGGAGCTTGATGGATCAGAAGTTGGAGGGTTTAGC
TTGAATGTGCAAGAAGCAAAACCAAGGGGTGACAGTGCAGGTGGAGGAGGCAGAGGTTTTGGTGGTAGAAGTGGTGGTAGGGGTGGAGGT
AGAGATAGTGGTGGTAGATTTGGTGGTCGTGGTGGTGGAGGCCGCTTTGGAGGTGGAGGCCCTTTGGTGGCGGTGGACXGCGGTGGAGGT
GGTGGACGTTTTGGCGGTGGAGGCAGAGGACGAGGAAATGCCAACAAGCCAAGCTTCACTCCATCTGGTAAGAAGACTACCTTTAGTGAC
GAGAACTTGGTCGCTATTGGCCAACTTATCTAA
Edits in Original Sequence 
GCTAATTACTAACTTATGATATATTATTGTCGCCGTTGCACAAAAGGGCCTATTTTTACACTATAAAAACAAGCTCAAGAAGATATTTCC
ATTCATTCTCTTTCGTTAAACCCTAAAGTTTTCCCTTAGGGTTTTATAGCTGTCTACTCCTCCCAGCTGCTTTTTTTCCCCCACAACTTG
TA
(5')ATGGGTAAATCTATCAAGAAGTCCGCCACCAAGGCTGATGCTGCTGTAGTTGCTCCAACCAAATCCATGAAGAAAGGGAAGAGA
GAAGCTGAGGATGAAATTGCCAAGTTGGTGAGTGCAAAGAAGCAGAAGAAAGATGTGGCTGTAGCACAAGCTGTTGAGAAAAAGAAAAGT
GATCTCAAAACTCAGAAGAAGAAGAAGCCAGTAAGCAGTTCCTCTGACGATAGCTCCTCTGAGTCGGAGTCTGAGGACGACAAGCCACTG
GTGCCTCCTAAGAAAGTGGCTCCTGCCAAAAAGGGAAAGGTAGCCAGCAGTTCTGATGACTCAGATTCTTCAGATGAGGATGAAGCTCCT
GCTAAGAAAGTTGTTGTAGCTTCAACTAAGAATGGCGTTGCTGCTAAGAAGAAAGATGAGTCAAGTGATGATTCGGATGATAGCAGCTCT
GAGGAAGATGTGCCTGCACCCAAGAAACCTCCTACTAATGGCGCTAAGAAAGACAAGTCAAGTGATGATTCTGATGATAGCAGCTCTGAG
GATGATGCTGTTGTTAAGAAGGCACCTGCTGTTGTTAAGAAGGCGCCTGCTGCTGCCTCTAAAAAGCAAGAATCCAGCTCTGATTCCAGT
GATGACTCCAGTTCAGATGATGATGATGAACCTCCCTCTAAGGTAGTTGCTCAACCTAAAAAGGCTCCTCAAGCTGTGAAGAAGACTGGT
GACAGCTCTGATGACTCTGATGATTCTGAATCTGATTCTGATTCAGACAAGGGAAAGGCTGCTACTGTAGCTAAAAAGACTGCTGCTGTA
TCTAAAAAGGTTGCTTCATCTGATGATGACAGTGAGGATGATAGTTCCGAGGAGAGTGATGAAGAGCCTCAAAAGAAAAAGAGCAAGCCC
TCGACCACACCAGCCGTCTCAAAAGCTCCAGAAAAGAGTAGCTCTGAGGAATCTTCTGACTCAGACGACTCCTCTGAAGATGAAGAGGAT
GACAAACCATCCAAAACTCCCAAGAAGGGTGCTGATGTAGAAATGGTTGATGCTCCTTCTGCTAAAGCTCAACAAACCCCTATTACTCCT
AAAGCCCAAACCCCAGGGGGATCGAAAACATTGTTTGTTGGAAATCTATCCTATTCAGTGGAACAGGCGGATGTGGAGAATTTCTTCAAA
GATGCTGGAGAAGTTCAGGAAGTGCGCTTTGCTACACATGAGGATGGTTCATTTAAGGGCTTTGGTCATGTTGAGTTTGTTACTGCTGAA
GCTGCGCATAAGGCACTTGAACTTAATGGGCATGATCTTTTGGGCCGTGATGTGAGGTTGGACCTGGCTCGTGAGAGGGGAGAGTATACA
CCTCGCAGTGGGAATGAGAACTCATTCCAGAGGCCGGCTAGAAGTGAGGGAACAACAATTTTTGTCAGGGGCTTTGACAAAAATGAGGCT
GAAGATCAGATTAGGAGTTCACTGGAGGAGCACTTTGCATCTTGTGGGAAGATCTTTAAAACAAGAATTCCTACAGACCCAGAAGGCTAT
ATTAAAGGGATGGCTTATATTGAGTTTGCAAATGGAGATGCTGATGCTCTAAACAAAGCTCTGGAGCTTGATGGATCAGAAGTTGGAGGG
TTTAGCTTGAATGTGCAAGAAGCAAAACCAAGGGGTGACAGTGCAGGTGGAGGAGGCAGAGGTTTTGGTGGTAGAAGTGGTGGTAGGGGT
GGAGGTAGAGATAGTGGTGGTAGATTTGGTGGTCGTGGTGGTGGAGGCCGCTTTGGAGGTGGAGGCCgCTTTGGTGGCGGTGGACXGCGG
TGGAGGTGGTGGACGTTTTGGCGGTGGAGGCAGAGGACGAGGAAATGCCAACAAGCCAAGCTTCACTCCATCTGGTAAGAAGACTACCTT
TAGTGACGAGtAACTTGGTCGCTATTGGCCAACTTATCTAA(3')ATCTCGTGGACGTTTTATCTTATTTTAAAAATATTATAAATTTTG
TTAGCAAGAACTTTAGTAGTTAGTAGACAAATGGGATAATTTTGTTTCTTTTGAGTTCATGTACCATTCTTTGTGGGTGGAAAATGAGAG
TTTGTTCAATGTTGATATCCAGTGTTTGTGGTATCTATCTCTTATATAATTGCTTCATATGACAAGTTATTTTTCTTCTCCCTTGTTAAT
GTTATTGATGTAGGTGGAATACCCCACCCAGCTCAAACATCAATGTAAATTTCCTCTTGTTTATGTATACTCAACAAATTTCACCATAAC
AAAATCCCCCCTTCCCTACTCATTGAACC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan