ESTScan Details for Unigene SGN-U572170

Score 
726
Direction 
Forward
Predicted Peptide Sequence 
MGGSCFLVLLLQIIVTQVVGVGVGVGVGVGVGVGPGGVWFGGGINSPNPGAVPSQSSAYTALQAWKSAITDDPSGILKNWVGPNVCSYKG
IFCSNSQDYMGNPTDPVVTDFQXIIPQTFRDLSSLVELDLSNNHFSGPFPTTVLFIPNLLYLDLRFNSFTGPIPEDLFNRKLDAIFLNNN
QFDGELPQSLGISPASVINFANNKFTGNIPFSLGDMGPRIKEILFFNNELNGCIPEGVGLWTDLQV*
Predicted Coding Sequence 
ATGGGGGGAAGTTGCTTTCTGGTTTTGCTTCTTCAAATCATAGTTACTCAAGTTGTTGGTGTTGGTGTTGGTGTTGGCGTTGGCGTTGGT
GTTGGTGTTGGACCTGGAGGTGTTTGGTTTGGTGGAGGGATCAACAGCCCAAACCCAGGAGCTGTCCCAAGTCAAAGTTCAGCATACACT
GCTCTTCAAGCATGGAAATCTGCAATTACTGATGATCCATCGGGGATTTTGAAGAATTGGGTGGGTCCAAATGTGTGTAGTTACAAAGGA
ATTTTCTGCTCAAACTCTCAAGATTACATGGGCAACCCAACAGACCCAGTTGTTACAGATTTTCAGGXTATAATTCCACAAACATTCAGA
GATCTGTCTTCACTCGTTGAATTAGACCTTAGTAACAACCATTTCTCAGGTCCATTCCCTACTACAGTACTATTCATCCCAAATCTTCTT
TATTTAGATCTCAGATTCAACAGTTTCACAGGCCCAATTCCCGAGGATCTGTTCAACAGAAAACTTGATGCTATTTTTCTTAATAATAAC
CAGTTTGATGGTGAACTACCTCAAAGTTTGGGAATTTCCCCTGCTTCAGTCATTAATTTTGCTAATAATAAGTTTACTGGCAACATTCCT
TTTAGTTTAGGGGACATGGGTCCGAGAATTAAGGAGATTTTGTTCTTTAACAATGAGTTAAATGGTTGTATACCAGAAGGTGTGGGATTA
TGGACGGATTTGCAAGTATAA
Edits in Original Sequence 
CATGGAAGAAGCAGCACCAACTAAACCCACATCGTCTCTCATCAATGCTACAATCACATTTTGTGCAACCTTGCAAAAAAAAGAAAAGAC
TCTTGTTTGATCAAAA
(5')ATGGGGGGAAGTTGCTTTCTGGTTTTGCTTCTTCAAATCATAGTTACTCAAGTTGTTGGTGTTGGTGTTG
GTGTTGGCGTTGGCGTTGGTGTTGGTGTTGGACCTGGAGGTGTTTGGTTTGGTGGAGGGATCAACAGCCCAAACCCAGGAGCTGTCCCAA
GTCAAAGTTCAGCATACACTGCTCTTCAAGCATGGAAATCTGCAATTACTGATGATCCATCGGGGATTTTGAAGAATTGGGTGGGTCCAA
ATGTGTGTAGTTACAAAGGAATTTTCTGCTCAAACTCTCAAGATTACATGGGCAACCCAACAGACCCAGTTGTTACAGATTTTCAGGXTA
TAATTCCACAAACATTCAGAGATCTGTCTTCACTCGTTGAATTAGACCTTAGTAACAACCATTTCTCAGGTCCATTCCCTACTACAGTAC
TATTCATCCCAAATCTTCTTTATTTAGATCTCAGATTCAACAGTTTCACAGGCCCAATTCCCGAGGATCTGTTCAACAGAAAACTTGATG
CTATTTTTCTTAATAATAACCAGTTTGATGGTGAACTACCTCAAAGTTTaGGGAATTTCCCCTGCTTCAGTCATTAATTTTGCTAATAAT
AAGTTTACTGGCAACATTCCTTTTAGTTTAGGGGACATGGGTCCGAGAATTAAGGAGATTTTGTTCTTTAACAATGAGTTAAATGGTTGT
ATACCAGAAGGTGTGGGATTATGGACGGATTTGCAAGTATAA(3')GATGTAAGTTTCAATTCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan