ESTScan Details for Unigene SGN-U572287

Score 
497
Direction 
Forward
Predicted Peptide Sequence 
XFVVTRYAVDGXFRDDCMIDTAHIPMTIVEPISIHFHYITITYLCTLDLDPVESTHGEIITGKAYTGYSQAGGIACITINRPHSLNSLTK
SMLTDLARIFKSLDADDSVRVIILTGSGRSFCSGIDLTAAEDVFKGDFRDMEIDPVFQMEQCRKPIIGAVAGFAVTGGFEISLACDILVA
SKDAKFLDTHARFGIFPSWGLSQKLSRIIGPSRAREVSLTATPINAEQAERWGLVNYVVDRSELLNKARQIAEAIIKNNQDLVLRYKAVI
NDGFKHDLTRALALEKERAHEYYDGMGKDYFKKMQEFIAGRNTSKPSSKL*
Predicted Coding Sequence 
XXTTTTGTCGTTACTCGTTACGCCGTTGATGGTAXATTTAGAGACGACTGCATGATTGACACGGCACACATTCCGATGACAATTGTTGAA
CCTATATCCATCCATTTTCATTATATAACTATTACATATCTGTGTACACTTGATTTGGATCCAGTAGAATCAACACATGGAGAAATCATC
ACCGGAAAAGCTTATACTGGTTACTCACAAGCCGGCGGGATTGCGTGTATCACAATCAACCGACCTCACTCCCTGAATTCTCTCACTAAG
TCAATGTTGACCGATCTTGCTCGGATTTTCAAGTCTCTGGACGCAGATGATTCGGTTCGGGTCATTATACTCACCGGATCGGGTCGATCG
TTCTGCTCCGGTATTGACCTGACGGCGGCGGAAGACGTGTTTAAGGGTGACTTCAGGGATATGGAGATTGATCCGGTGTTCCAAATGGAG
CAATGTAGGAAGCCAATTATTGGGGCTGTTGCTGGATTTGCTGTTACTGGCGGTTTTGAGATTTCTCTCGCTTGTGATATCTTGGTTGCC
TCCAAAGATGCTAAATTTTTGGATACTCATGCTAGGTTTGGGATATTTCCTTCTTGGGGTCTATCACAGAAACTATCTCGAATTATTGGA
CCCAGCCGAGCTCGTGAAGTGTCCTTAACTGCAACACCTATCAACGCAGAACAGGCTGAGAGATGGGGCTTGGTAAATTATGTTGTTGAC
AGAAGTGAACTTTTGAACAAAGCTAGGCAAATTGCAGAAGCCATCATCAAGAACAACCAAGACTTGGTTTTGAGGTACAAGGCAGTTATC
AATGATGGGTTCAAACATGACTTGACCCGAGCCCTTGCTCTTGAGAAGGAGAGGGCTCACGAGTATTATGATGGAATGGGCAAAGATTAC
TTTAAGAAAATGCAAGAGTTCATTGCAGGACGGAATACAAGCAAACCTTCATCAAAATTATAG
Edits in Original Sequence 
(5')XXTTTTGTCGTTACTCGTTACGCCGTTGATGGTAXATTTAGAGACGACTGCATGATTGACACGGCACACATTCCGATGACAAtTTG
TTGAACCTATATCCATCCATTTTCATTATATAACTATTACATATCTGTGTACACTTGATTTGaGATCCAGTAGAATCAACACATGGAGAA
ATCATCACCGGAAAAGCTTATACTGGTTACTCACgAAGCCGGCGGGATTGCGTGTATCACAATCAACCGACCTCACTCCCTGAATTCTCT
CACTAAGTCAATGTTGACCGATCTTGCTCGGATTTTCAAGTCTCTGGACGCAGATGATTCGGTTCGGGTCATTATACTCACCGGATCGGG
TCGATCGTTCTGCTCCGGTATTGACCTGACGGCGGCGGAAGACGTGTTTAAGGGTGACTTCAGGGATATGGAGATTGATCCGGTGTTCCA
AATGGAGCAATGTAGGAAGCCAATTATTGGGGCTGTTGCTGGATTTGCTGTTACTGGCGGTTTTGAGATTTCTCTCGCTTGTGATATCTT
GGTTGCCTCCAAAGATGCTAAATTTTTGGATACTCATGCTAGGTTTGGGATATTTCCTTCTTGGGGTCTATCACAGAAACTATCTCGAAT
TATTGGACCCAGCCGAGCTCGTGAAGTGTCCTTAACTGCAACACCTATCAACGCAGAACAGGCTGAGAGATGGGGCTTGGTAAATTATGT
TGTTGACAGAAGTGAACTTTTGAACAAAGCTAGGCAAATTGCAGAAGCCATCATCAAGAACAACCAAGACTTGGTTTTGAGGTACAAGGC
AGTTATCAATGATGGGTTCAAACATGACTTGACCCGAGCCCTTGCTCTTGAGAAGGAGAGGGCTCACGAGTATTATGATGGAATGGGCAA
AGATTACTTTAAGAAAATGCAAGAGTTCATTGCAGGACGGAATACAAGCAAACCTTCATCAAAATTATAG(3')ATTTATCACGTGTAAT
TTATTTTCTGCTTTTGACATAAACTAGTCTCGAGCAGTTTTTTTGGTCAAAAGGTGAAATAAAATGAAATGTTGCTCCAATTATTCTCAT
TT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan