ESTScan Details for Unigene SGN-U572460

Score 
1747
Direction 
Forward
Predicted Peptide Sequence 
MSVKTVQVNNVSLGAKEQDIKEFFSFSGDIEYLEMKGESERSQAAYVTFKDPQSAETAVLLSGATIVDQSISIVLAPEYKLPPTASVSPV
PNESTTAPAAGSAIQKAEDVVSSMLAKGFILGKDAVGKAKALDERHKITSTTSATVASIDQKYGLSEKITTGATIVNHKVKEMDQKFQVS
EKSKSAFAAAEQTVSNAGSAIMKNRYALTGVTWAAGALSRVTKAAGEVGQKTKEKLAEEERRTFTKGHAQENTATSTKGNVQQQAADTAK
GDVQELTPASAKGDVQELAAASAKGDVQELATASAKGDVQELAAASAKSNVQEHAATSAKNDVQEVAATTAKQEHTETQIGVEESTNPSL
PPKA*
Predicted Coding Sequence 
ATGTCGGTTAAAACAGTGCAAGTGAACAATGTTTCTTTGGGTGCTAAAGAGCAAGATATCAAGGAGTTCTTCTCCTTCTCTGGGGATATT
GAATATTTAGAGATGAAAGGTGAGAGTGAGCGATCACAAGCTGCTTATGTAACATTCAAGGATCCTCAGAGTGCAGAGACCGCAGTTCTT
CTTTCAGGAGCTACAATTGTTGATCAGTCCATCTCAATAGTCCTAGCACCTGAGTACAAGCTCCCACCTACAGCTTCAGTATCACCAGTT
CCAAATGAAAGCACCACTGCACCCGCTGCTGGATCTGCTATTCAAAAGGCAGAGGATGTAGTCAGCAGCATGTTGGCAAAGGGCTTTATC
TTGGGCAAGGACGCAGTTGGCAAAGCCAAGGCACTAGACGAGAGACACAAGATCACATCCACTACCTCAGCCACAGTTGCTTCTATAGAC
CAAAAATATGGCCTTAGTGAGAAAATCACTACAGGAGCGACCATTGTGAACCACAAAGTGAAAGAAATGGACCAGAAGTTCCAAGTCTCA
GAAAAGTCAAAATCTGCTTTTGCAGCTGCTGAACAGACAGTTAGCAATGCTGGATCTGCCATCATGAAGAACAGATATGCTTTGACCGGT
GTAACTTGGGCTGCAGGTGCATTAAGTCGAGTCACTAAGGCTGCCGGGGAAGTGGGACAGAAGACAAAGGAAAAACTGGCTGAAGAAGAA
AGAAGAACTTTTACTAAAGGTCATGCACAAGAAAATACTGCAACTTCAACAAAAGGTAATGTGCAACAACAAGCTGCAGATACCGCTAAA
GGTGATGTCCAAGAACTCACTCCAGCTTCTGCTAAAGGTGATGTGCAAGAACTTGCTGCAGCTTCTGCTAAAGGTGATGTGCAAGAACTT
GCTACAGCTTCTGCTAAAGGTGATGTACAAGAACTTGCTGCAGCTTCTGCCAAAAGTAATGTGCAAGAACATGCTGCAACTTCTGCTAAA
AATGATGTGCAAGAAGTTGCAGCAACTACTGCAAAACAAGAACATACCGAGACTCAAATCGGAGTTGAGGAATCCACCAATCCCTCTCTT
CCACCAAAAGCTTAA
Edits in Original Sequence 
GCTCAGATTGATCTGCTATCTTTTTTCTATCTCGATCC(5')ATGTCGGTTAAAACAGTGCAAGTGAACAATGTTTCTTTGGGTGCTAAA
GAGCAAGATATCAAGGAGTTCTTCTCCTTCTCTGGGGATATTGAATATTTAGAGATGAAAGGTGAGAGTGAGCGATCACAAGCTGCTTAT
GTAACATTCAAGGATCCTCAGAGTGCAGAGACCGCAGTTCTTCTTTCAGGAGCTACAATTGTTGATCAGTCCATCTCAATAGTCCTAGCA
CCTGAGTACAAGCTCCCACCTACAGCTTCAGTATCACCAGTTCCAAATGAAAGCACCACTGCACCCGCTGCTGGATCTGCTATTCAAAAG
GCAGAGGATGTAGTCAGCAGCATGTTGGCAAAGGGCTTTATCTTGGGCAAGGACGCAGTTGGCAAAGCCAAGGCACTAGACGAGAGACAC
AAGATCACATCCACTACCTCAGCCACAGTTGCTTCTATAGACCAAAAATATGGCCTTAGTGAGAAAATCACTACAGGAGCGACCATTGTG
AACCACAAAGTGAAAGAAATGGACCAGAAGTTCCAAGTCTCAGAAAAGTCAAAATCTGCTTTTGCAGCTGCTGAACAGACAGTTAGCAAT
GCTGGATCTGCCATCATGAAGAACAGATATGCTTTGACCGGTGTAACTTGGGCTGCAGGTGCATTAAGTCGAGTCACTAAGGCTGCCGGG
GAAGTGGGACAGAAGACAAAGGAAAAACTGGCTGAAGAAGAAAGAAGAACTTTTACTAAAGGTCATGCACAAGAAAATACTGCAACTTCA
ACAAAAGGTAATGTGCAACAACAAGCTGCAGATACCGCTAAAGGTGATGTCCAAGAACTCACTCCAGCTTCTGCTAAAGGTGATGTGCAA
GAACTTGCTGCAGCTTCTGCTAAAGGTGATGTGCAAGAACTTGCTACAGCTTCTGCTAAAGGTGATGTACAAGAACTTGCTGCAGCTTCT
GCCAAAAGTAATGTGCAAGAACATGCTGCAACTTCTGCTAAAAATGATGTGCAAGAAGTTGCAGCAACTACTGCAAAACAAGAACATACC
GAGACTCAAATCGGAGTTGAGGAATCCACCAATCCCTCTCTTCCACCAAAAGCTTAA(3')TCCAACATTATCTTGAAAGTAAATGCGCG
ATTTACGCTAGTTTGTTATTCGAATTTGCACAGGTCATTATGTATCAACTATGGTATTTATACATGGAATCTTATTTCTTAGGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan