ESTScan Details for Unigene SGN-U572570

Score 
323
Direction 
Forward
Predicted Peptide Sequence 
MEFSHFLTGLFAGKQSLYLILLLNFIPIFVTPATTERDTLLKIKRQWGNPSALDSWNSTSSPCSWPEIECDDGKVTGIILQEKDITVEIP
TSICELKNLTLLNLRLNYLPGEFPTFLYKCSNLQHLDLSQNYFVGTIPEDIHRLGKLKYLNLGGNNFTGDIPPSVGNLTELENLCMDLKL
FNGSFPAEIGNLXNLESLGLEFNGFSPMXXPXXXX
Predicted Coding Sequence 
ATGGAGTTTTCCCATTTTCTGACCGGCTTATTCGCCGGGAAACAGTCCCTTTATCTCATTTTACTACTAAACTTCATACCCATTTTTGTA
ACTCCGGCCACTACTGAACGTGACACTCTACTGAAGATAAAACGTCAATGGGGAAACCCATCAGCACTTGATTCATGGAACTCTACTTCT
TCTCCTTGTAGCTGGCCGGAGATTGAGTGTGATGATGGGAAGGTTACCGGTATAATACTTCAAGAAAAAGATATAACTGTTGAAATTCCG
ACTTCTATTTGTGAACTTAAAAATCTTACTTTGCTTAATCTCCGGTTGAATTATCTTCCCGGTGAATTCCCAACTTTTCTTTACAAATGT
TCCAATTTGCAGCATTTGGATCTTTCTCAGAATTACTTTGTGGGTACCATCCCGGAGGATATTCACCGGCTTGGGAAACTCAAGTATCTT
AATCTGGGTGGTAATAATTTCACCGGAGATATCCCGCCATCGGTCGGGAATTTGACGGAACTGGAGAACCTGTGTATGGATTTGAAACTG
TTTAATGGGAGTTTCCCAGCGGAAATCGGGAACTTGNCCAATCTTGAAAGTTTGGGGTTGGAGTTCAATGGGTTTTCTCCNATGANANTA
CCGCNNNAGTTNGXX
Edits in Original Sequence 
GATGGAATCAATACTTTACTCACCCACTTTACTTATTTTAATCAAAAAAATGATAAACTTTTGATCGAAAAATTTTATCTCTATATATTC
ATTTTTATCAATTTGGCTTTTCTTCACACCTCCAATGTTTGACCAAACTTTACAAAATCAAATCGTAATTTTATTC
(5')ATGGAGTTTT
CCCATTTTCTGACCGGCTTATTCGCCGGGAAACAGTCCCTTTATCTCATTTTACTACTAAACTTCATACCCATTTTTGTAACTCCGGCCA
CTACTGAACGTGACACTCTACTGAAGATAAAACGTCAATGGGGAAACCCATCAGCACTTGATTCATGGAACTCTACTTCTTCTCCTTGTA
GCTGGCCGGAGATTGAGTGTGATGATGGGAAGGTTACCGGTATAATACTTCAAGAAAAAGATATAACTGTTGAAATTCCGACTTCTATTT
GTGAACTTAAAAATCTTACTTTGCTTAATCTCCGGTTGAATTATCTTCCCGGTGAATTCCCAACTTTTCTTTACAAATGTTCCAATTTGC
AGCATTTGGATCTTTCTCAGAATTACTTTGTGGGTACCATCCCGGAGGATATTCACCGGCTTGGGAAACTCAAGTATCTTAATCTGGGTG
GTAATAATTTCACCGGAGATATCCCGCCATCGGTCGGGAATTTGACGGAACTGGAGAACCTGTGTATGGATTTGAAACTGTTTAATGGGA
GTTTCCCAGCGGAAATCGGGAACTTGNCCAATCTTGAAAGTTTGGGGTTGGAGTTCAATGGGTTTTCTCCNATGANANTACCGCNNNAGT
TNGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan