ESTScan Details for Unigene SGN-U572573

Score 
1028
Direction 
Forward
Predicted Peptide Sequence 
MNGLCPYYLHVQI*CFEQLETSGSQGKQYRELCDYQRYTCSNENAXFDQIMKCELGLHIFTNSCNKIDLFILXVKTYMIYLTGIKRMSYL
RNLQFESLNSNSSRVIQSLKSFSFLKSLSYEDSDLTAPTIIYGKLKIEFYLTSSIPLFLLKYEKSFYFFILSLSIKKSEHGGVPILEGSS
VNDNFLPNIGQMTSLKVLSMPSGENNGTLPNQGWCELKHIEEVDFLDNNFEGTLPSCLGNLTSLRWLCLAMNYFRGNIVSHSIWRRLTSL
EYLDISHNQFEVPLSFSQFSNYTKLIYLDVGYSTIIPDTEFQNWIPNFQLEFFGIYGYIKLQKLPSFLHYQYDLRILVIDENQLQGKFQT
WLLENNTRLAGFYSRDNAFDGPFKLPSIVHLYLETIDVSNNKLNGHIPANMSLAFPKLSFLNMSQNYLEGPIPSMFCGTHLEFLDLSVNK
LSGEVPVDLTIGSPQLLYLRLSNNKLKGHMFLEVKSHVLSFLYLNGNNFEGPLPENIFLRSLIVLDASRNSFTGEIPRWITDNKRLLQLD
LSNNHLQGLIPVEICNLKFLNVLAISENRLSGFIPSCVSSLPLKHIHLEKNQLGGELGHVLFNFSSLITLDLRRNNFAGNISHAIGSLTN
LNYLLLSHNQLEGQIPTQICMLNDLSIIDLSFNMLYGPLPPCLGYLTRTKKDAEISWTYYPATSTRSWLSFEIWMRSKRHYHDSHGLPSD
LFLMDVETQVQFSTKRNSYTYKGSILKYMSGIDLSSNRLTGEIPVELGNMSNIHALNLSHNHLNGRIPNTFSNLQEIESLDLSCNRLNGS
IPVGLLELNSLAVFSVAYNNLSGAVPDFKGQFGTFDKSSYEGNPFLCGYPLDNKCGILSPKLSKINRDEEESSELECFYIGLVVSYGAIL
LGLAAAALLE*
Predicted Coding Sequence 
ATGAATGGTTTGTGTCCTTACTATTTGCATGTGCAGATATAATGCTTTGAGCAACTTGAAACATCTGGATCTCAGGGCAAACAATATAGA
GAGCTTTGTGACTACCAAAGGTACACATGCTCTAATGAAAATGCAAAXTTTGATCAGATAATGAAATGTGAACTAGGATTACACATCTTT
ACTAACTCATGTAATAAGATTGATTTATTCATTCTTXATGTAAAAACATATATGATTTATTTAACAGGTATCAAAAGAATGAGTTATTTG
CGAAATTTACAATTCGAAAGTCTTAACTCCAACTCGAGCAGAGTCATACAATCCCTAAAATCATTCTCATTTCTTAAATCACTTTCTTAT
GAAGATAGTGATCTCACTGCTCCCACCATAATTTATGGTAAGCTCAAAATTGAATTTTATCTAACTTCTTCTATTCCACTTTTTCTTTTG
AAATATGAAAAATCCTTTTATTTTTTTATTTTATCGTTAAGCATTAAGAAATCTGAGCACGGTGGAGTACCTATACTTGAAGGATCTTCT
GTAAATGACAACTTTCTCCCAAACATTGGACAAATGACTTCTCTTAAAGTGTTGAGTATGCCTTCTGGTGAAAATAATGGCACCCTCCCT
AATCAAGGTTGGTGTGAACTCAAACACATTGAAGAAGTGGATTTTTTAGACAATAATTTTGAGGGAACACTGCCTTCGTGTCTTGGAAAC
TTGACATCACTTCGATGGTTGTGTTTGGCCATGAATTACTTTAGAGGAAATATAGTGTCACATTCTATTTGGAGGAGACTTACATCACTT
GAGTACCTTGATATTTCACATAACCAATTTGAAGTTCCTCTGTCATTCAGCCAATTTTCCAACTATACGAAATTGATCTACTTGGATGTT
GGTTATAGTACAATAATTCCAGATACCGAGTTCCAAAATTGGATCCCGAATTTCCAGTTGGAGTTTTTTGGTATATATGGATATATAAAG
CTTCAAAAGTTGCCTTCTTTCCTTCACTATCAATATGACTTGAGGATTCTTGTTATAGATGAAAATCAATTGCAAGGAAAGTTCCAGACA
TGGTTATTAGAAAATAACACCAGACTTGCAGGGTTTTATAGTAGAGATAATGCTTTCGACGGACCATTCAAGTTGCCATCGATTGTTCAC
CTCTATCTAGAGACGATTGATGTTTCTAATAACAAACTAAACGGGCATATTCCAGCAAATATGAGTTTAGCCTTTCCGAAGCTTAGTTTT
TTGAACATGTCACAAAATTATCTTGAAGGTCCTATACCTTCCATGTTTTGTGGCACTCATTTAGAATTCCTAGACCTATCTGTTAATAAG
TTGTCCGGAGAAGTTCCTGTTGATCTGACAATTGGTTCTCCCCAATTGTTGTACCTTCGGTTGTCAAACAACAAGCTGAAAGGACATATG
TTTTTGGAGGTCAAGTCACATGTATTGTCCTTTTTGTATTTGAATGGCAATAACTTTGAAGGACCACTGCCTGAGAACATTTTTCTCAGA
TCCCTTATTGTACTTGACGCTAGCAGGAATAGTTTCACTGGGGAGATTCCGAGATGGATTACAGATAATAAAAGATTGTTACAGCTTGAT
TTGTCCAATAATCATCTCCAAGGTTTGATTCCAGTTGAGATTTGCAATTTGAAGTTTCTTAATGTCTTAGCTATATCCGAAAACAGGCTT
TCAGGATTTATACCTTCTTGTGTGAGTTCTTTACCTCTCAAACACATCCATTTGGAGAAAAATCAATTGGGTGGTGAATTGGGACATGTA
CTTTTCAACTTCTCTTCACTGATAACTTTGGACCTTCGCCGCAACAATTTTGCAGGAAATATCTCACACGCCATAGGCTCACTTACTAAT
CTCAACTACCTTCTCCTTAGCCATAACCAATTGGAAGGGCAGATTCCAACTCAGATATGTATGCTGAACGACTTATCTATCATAGATTTA
TCTTTCAATATGCTTTATGGTCCTCTCCCTCCTTGTTTGGGTTACTTAACACGGACCAAAAAGGATGCAGAGATAAGTTGGACTTATTAT
CCTGCGACTTCCACGCGTTCATGGTTAAGTTTTGAGATCTGGATGCGTTCGAAAAGGCATTATCACGATAGTCATGGACTTCCAAGTGAC
TTGTTTTTGATGGATGTGGAAACTCAGGTCCAGTTTTCAACAAAAAGAAACTCATACACTTACAAGGGAAGCATTCTTAAATATATGTCG
GGTATTGATCTCTCAAGTAATAGATTGACAGGTGAAATTCCTGTTGAGTTAGGGAACATGAGCAATATACATGCATTGAATCTATCGCAC
AACCATCTCAACGGAAGAATACCAAATACCTTCTCCAACCTACAGGAAATTGAGAGCTTAGACCTTTCCTGCAACAGATTGAATGGGAGC
ATTCCTGTTGGTCTACTTGAGCTGAATTCTTTGGCAGTATTCAGTGTTGCATACAACAACTTATCTGGTGCAGTGCCTGATTTTAAAGGT
CAATTTGGAACTTTTGACAAAAGCAGCTACGAGGGAAATCCTTTTCTTTGCGGTTATCCATTAGATAACAAGTGTGGGATATTGAGTCCT
AAATTGTCAAAGATTAATAGAGATGAGGAGGAATCATCAGAATTGGAGTGTTTTTACATTGGGTTAGTTGTGTCATATGGAGCGATCTTG
TTGGGATTAGCTGCAGCXGCTCTGCTTGAATAA
Edits in Original Sequence 
GCTAGAAAAACAATATGGGGAACGTTAAGTTTTTGTTGTTCGTGTTTTTTCTAATACTAATAATGGCGAATGGTTGTTGGGAGGAAGAGA
GAAGTGCTCTCTTGGATCTTCAAGCAAGTATAATAAGTTCAAATAGTGAATTGTTGGTCGATTGGGCTGGATATAATAATTCTAATGGTT
TTACAGATTGTTGTTTCTGGAAAAGGGTAAAATGCAGCTTAGAAACAGGTCGAGTGATCAAACTCAATCTCAAAACAAAATTTGGTAGAG
GGGATGGTTGGAGATTTAATGCCTCTCTCTTTCTTCCATTCAAGTCACTGCAAGTTCTGGTATTGTCTTCCCGAAATATTATAGGGTGGA
CAAAAAATGAAGGTATATATGGAGTATTATGACTTGTGAAAACTGATGAAACAAATTACTACTAACATGTTAATTTCTTTGTTATCCAAT
CCAGGTTTCAGTAAACTAAGGCAGCTGCCTAACCTGAAAGAAGTGGATTTGCAATATAATTCCATCCATCCTCAAGTTTTACTATCATCT
TTGTGTTCGATTTCATCTCTCGAGGTTCTAAAACTTGGTGTAGATGTTGATACCTCTTTCAGCATACCAACGCCATATAATAGCACTAGC
ATGAAGAGTAAGAAATGTGGAGGAGGACTAAGCAATTTAAGAGAACTTTGGTTTGAAGGTTAAGGAATTGATGACATAAATATCCTTTCT
GCATTGGGTAAGGTGTCCTTTCCACAAGAGAAATTCAGAAAAATCAATTCACACTAATTCCAAGTACAATTTACTTTTCATAAATCAAAT
GCAGGCAGACTGAGGAATTTACAGAAACTCAATTTGAATTTTAATAACTTCAATTCCACCATCTTTTCATCGCTCAAGATTTTTCCGTCT
CTCAAGCATCTCAATCTCGCTGCCAATGAAATAAATGGAAATATCGAAATGAATGGTTTGTTACACTCTCTTCCCATAAAAGTCTTACCC
GCTAACCATATTTTGCTCCACTAAGATGCATCTAAATAAATGGAAATATCAAA
(5')ATGAATGGTTTGTGTCCTTACTATTTGCATGTG
CAGATATAAtTGCTTTGAGCAACTTGAAACATCTGGATCTCAGGGCAAACAATATAGAGAGCTTTGTGACTACCAAAGGTACACgATGCT
CTAATGAAAATGCAAAXTTTGATCAGATAATGAAATGTGAACTAGGATTACACATCTTTACTAACTCATGTAATAAGATTGATTTATTCA
TTCTTXATGTAAAAACATATATGATTTATTTAACAGGTATCAAAAGAATGAGTTATTTGCGAAATTTACAATTCGAAAGTCTTAACTCCA
ACTCGAGCAGAGTCATACAATCCCTAAAATCATTCTCATTTCTTAAATCACTTTCTTATGAAGATAGTGATCTCACTGCTCCCACCATAA
TTTATGGTAAGCTCAAAATTGAATTTTATCTAACTTaCTTCTATTCCACTTTTTCTTTTGAAATATGAAAAATCCTTTTATTTTTTTATT
TTATCGTaTAAGCATTAAGAAATCTGAGCACGGTGGAGTACCTATACTTGAAgGGATCTTCTGTAAATGACAACTTTCTCCCAAACATTG
GACAAATGACTTCTCTTAAAGTGTTGAGTATGCCTTCTGGTGAAAATAATGGCACCCTCCCTAATCAAGGTTGGTGTGAACTCAAACACA
TTGAAGAAGTGGATTTTTTAGACAATAATTTTGAGGGAACACTGCCTTCGTGTCTTGGAAACTTGACATCACTTCGATGGTTGTGTTTGG
CCATGAATTACTTTAGAGGAAATATAGTGTCACATTCTATTTGGAGGAGACTTACATCACTTGAGTACCTTGATATTTCACATAACCAAT
TTGAAGTTCCTCTGTCATTCAGCCAATTTTCCAACTATACGAAATTGATCTACTTGGATGTTGGTTATAGTACAATAATTCCAGATACCG
AGTTCCAAAATTGGATCCCGAATTTCCAGTTGGAGTTTTTTGGTATATATGGATATATAAAGCTTCAAAAGTTGCCTTCTTTCCTTCACT
ATCAATATGACTTGAGGATTCTTGTTATAGATGAAAATCAATTGCAAGGAAAGTTCCAGACATGGTTATTAGAAAATAACACCAGACTTG
CAGGGTTTTATAGTAGAGATAATGCTTTCGACGGACCATTCAAGTTGCCATCGATTGTTCACCTCTATCTAGAGACGATTGATGTTTCTA
ATAACAAACTAAACGGGCATATTCCAGCAAATATGAGTTTAGCCTTTCCGAAGCTTAGTTTTTTGAACATGTCACAAAATTATCTTGAAG
GTCCTATACCTTCCATGTTTTGTGGCACTCATTTAGAATTCCTAGACCTATCTGTTAATAAGTTGTCCGGAGAAGTTCCTGTTGATCTGA
CAATTGGTTCTCCCCAATTGTTGTACCTTCGGTTGTCAAACAACAAGCTGAAAGGACATATGTTTTTGGAGGTCAAGTCACATGTATTGT
CCTTTTTGTATTTGAATGGCAATAACTTTGAAGGACCACTGCCTGAGAACATTTTTCTCAGATCCCTTATTGTACTTGACGCTAGCAGGA
ATAGTTTCACTGGGGAGATTCCGAGATGGATTACAGATAATAAAAGATTGTTACAGCTTGATTTGTCCAATAATCATCTCCAAGGTTTGA
TTCCAGTTGAGATTTGCAATTTGAAGTTTCTTAATGTCTTAGCTATATCCGAAAACAGGCTTTCAGGATTTATACCTTCTTGTGTGAGTT
CTTTACCTCTCAAACACATCCATTTGGAGAAAAATCAATTGGGTGGTGAATTGGGACATGTACTTTTCAACTTCTCTTCACTGATAACTT
TGGACCTTCGCCGCAACAATTTTGCAGGAAATATCTCACACGCCATAGGCTCACTTACTAATCTCAACTACCTTCTCCTTAGCCATAACC
AATTGGAAGGGCAGATTCCAACTCAGATATGTATGCTGAACGACTTATCTATCATAGATTTATCTTTCAATATGCTTTATGGTCCTCTCC
CTCCTTGTTTGGGTTACTTAACACGGACCAAAAAGGATGCAGAGATAAGTTGGACTTATTATCCTGCGACTTCCACGCGTTCATGGTTAA
GTTTTGAGATCTGGATGCGTTCGAAAAGGCATTATCACGATAGTCATGGACTTCCAAGTGACTTGTTTTTGATGGATGTGGAAACTCAGG
TCCAGTTTTCAACAAAAAGAAACTCATACACTTACAAGGGAAGCATTCTTAAATATATGTCGGGTATTGATCTCTCAAGTAATAGATTGA
CAGGTGAAATTCCTGTTGAGTTAGGGAACATGAGCAATATACATGCATTGAATCTATCGCACAACCATCTCAACGGAAGAATACCAAATA
CCTTCTCCAACCTACAGGAAATTGAGAGCTTAGACCTTTCCTGCAACAGATTGAATGGGAGCATTCCTGTTGGTCTACTTGAGCTGAATT
CTTTGGCAGTATTCAGTGTTGCATACAACAACTTATCTGGTGCAGTGCCTGATTTTAAAGGTCAATTTGGAACTTTTGACAAAAGCAGCT
ACGAGGGAAATCCTTTTCTTTGCGGTTATCCATTAGATAACAAGTGTGGGATATTGAGTCCTAAATTGTCAAAGATTAATAGAGATGAGG
AGGAATCATCAGAATTGGAGTGTTTTTACATTGGGTTAGTTGTGTCATATGGAGCGATCTTGTTGGGATTAGCTGCAGCXGCTCTGCTTG
AATAA(3')TCATTGGAGAAGAGCATGGTTTAGGATGATAGAGGCATTGATGTTTTATTGTTACTATTTTGTGTTGGACAACATTGTTAC
ACCCATCAAGAGTAGAAGGTTGATTAATTAGGTAGTTCTTTTAAAAATATTGTTGCATGTCTATCACTATATATTATTATGTTGTCATTC
TATTTTATAAATATTTTTTTGTATGAATTAAAATGTTCCATTTTCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan