ESTScan Details for Unigene SGN-U572790

Score 
301
Direction 
Forward
Predicted Peptide Sequence 
MGRFRKDQVVYERKKNAEDELRIVGXEIDGIVHEFLVGDTYHPISDNIYVKLGELSKELREVGYVPRTEYVLFDIEEEEKEHFVGCHSEK
LALAYGLLSTKPGDGIRIIKNLRICGDCHTFFKLVSMIRGEKLSYEIITVSIVSLKVHALVAITGKTSVGNMMLQKRIEANWCHSLMQE*
Predicted Coding Sequence 
ATGGGACGATTCAGAAAAGATCAGGTCGTCTATGAACGAAAGAAGAATGCAGAAGATGAGCTGCGTATAGTTGGAXTAGAGATTGATGGA
ATAGTTCATGAGTTTCTTGTTGGAGATACATACCATCCAATATCAGATAACATATACGTCAAACTCGGTGAACTGAGCAAGGAGCTAAGA
GAGGTAGGTTATGTTCCAAGAACAGAATACGTTCTATTTGACATCGAAGAGGAGGAGAAGGAGCATTTCGTGGGGTGTCATAGTGAGAAG
CTCGCGCTTGCATATGGCTTACTAAGTACGAAACCTGGTGATGGTATCAGGATAATAAAGAATCTTCGTATCTGTGGTGATTGCCATACG
TTCTTCAAGCTTGTCTCAATGATAAGGGGAGAGAAATTATCTTACGAGATAATAACCGTTTCCATTGTTTCCTTGAAGGTTCATGCTCTT
GTGGCGATTACTGGTAAGACTTCAGTTGGTAATATGATGTTGCAGAAGAGAATTGAGGCCAATTGGTGCCATTCCCTTATGCAAGAATAG
Edits in Original Sequence 
TAGTGGATCCCCTTGAGATGCATGAATTCCGCACGAGATTTATCAAATATATATGCATCTAACAATAA(5')ATGGGACGATTCAGAAAA
GATCAGGTCGTCTATGAACGAAAGAAGAATGCAGAAGATGAGCTGCGTATAGTTGGAXTAGAGATTGATGGAATAGTTCATGAGTTTCTT
GTTGGAGATACATACCATCCAATATCAGATAACATATACGTCAAACTCGGTGAACTGAGCAAGGAGCTAAGAGAGGTAGGTTATGTTCCA
AGAACAGAATACGTTCTATTTGACATCGAAGAGGAGGAGAAGGAGCATTTCGTGGGGTGTCATAGTGAGAAGCTCGCGCTTGCATATGGC
TTACTAAGTACGAAACCTGGTGATGGTATCAGGATAATAAAGAATCTTCGTATCTGTGGTGATTGCCATACGTTCTTCAAGCTTGTCTCA
ATGATAAcGGGGAGAGAAATTATCTTACGAGATAATAACCGTTTCCATTGTTTCCTTGAAGGTTCATGCTCTTGTGGCGATTACTGGTAA
GACTTCAGTTGGTAATATGATGTTGCAGAAGAGAATTGAGGCCAATTGGTGCCATTCCCTTATGCAAGAATAG(3')ATAGACCTAATAT
TTATCTTTCATCAGCTCGATAAGACCAATGGGTGGTTGATTGACTTGTGACCTGTAGGTCATA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan