ESTScan Details for Unigene SGN-U572850

Score 
1278
Direction 
Forward
Predicted Peptide Sequence 
XSPHFPITTKKKLKASSSQFNNQLVKLDYXLLSMSVERTFKKLVSGVILDLDGTLLNTDGIVSEILKVFLVKYGKQWDGREAPHIVGKTP
TEAAAAVVEDYGLPLSRDEFLSQFYPMLSDQWRNIKALPGANRLINHLSGHGVPMALASNSSKSNIEAKIFHHAGWKESFSAIVGGDEVK
AGKPSPEIFLEAAKRLNMDPSSFLVIEDSIPGVTAGKDAGMAVVAVPSLAKQSHLYTSADEVINSLLDLQLEKWGLPAFQDRIEGTLPLE
PWYIGGPVIKGFGRGSKVLGIPTANLSPQGYSAILSEHPAGVYFGWAGLSGRGVYKMVMSIGWNPFFNNTEKTVEPWLLHDFNEDFYGEE
LHLVVVGYIRPEANFSSLEALIAKIHEDRKIAERALELPQYLKYKDDPYLKSSLHQQN*
Predicted Coding Sequence 
XGGAGTCCCCATTTCCCCATAACAACCAAGAAAAAGTTGAAGGCTTCATCTTCTCAGTTCAATAATCAATTGGTGAAGTTGGATTATAAX
TTGCTCTCCATGTCTGTTGAACGAACTTTCAAGAAGCTAGTTTCTGGTGTCATCCTTGATTTGGATGGTACACTTCTTAATACAGATGGC
ATTGTGAGTGAGATTTTAAAGGTTTTCTTAGTTAAGTATGGAAAGCAATGGGATGGGAGAGAAGCTCCCCACATAGTAGGGAAAACCCCA
ACAGAAGCTGCTGCTGCCGTTGTTGAAGATTATGGGCTGCCACTGTCAAGAGATGAATTTCTTTCGCAATTTTACCCAATGCTGTCTGAT
CAGTGGCGCAATATCAAAGCTCTTCCAGGGGCCAATCGATTGATTAACCATTTGAGCGGTCATGGTGTACCCATGGCATTGGCGTCAAAT
TCTTCTAAATCTAACATTGAGGCCAAAATTTTTCATCATGCAGGATGGAAAGAGTCCTTCTCAGCTATTGTTGGAGGAGATGAAGTGAAA
GCTGGAAAGCCGTCTCCGGAAATATTTCTTGAAGCAGCTAAAAGACTCAACATGGATCCATCCAGCTTTCTTGTCATTGAAGATTCAATA
CCAGGTGTTACTGCTGGTAAAGATGCTGGAATGGCAGTAGTTGCTGTACCATCTCTTGCAAAGCAGTCTCATCTTTATACCTCTGCTGAT
GAAGTGATCAATTCTCTTCTAGATTTGCAACTAGAAAAGTGGGGACTACCTGCATTTCAAGATAGGATAGAAGGTACTTTGCCTTTAGAA
CCTTGGTATATAGGTGGTCCTGTCATTAAGGGATTTGGGCGCGGCTCAAAGGTTCTCGGGATCCCCACAGCTAATTTATCCCCACAAGGT
TATTCAGCCATTCTTTCAGAACATCCAGCGGGTGTATATTTTGGATGGGCAGGACTATCAGGTCGAGGTGTCTACAAGATGGTCATGAGC
ATTGGTTGGAATCCTTTCTTCAACAATACAGAGAAGACGGTTGAACCATGGTTGCTTCATGACTTCAATGAGGACTTCTATGGTGAGGAA
TTGCATCTAGTTGTTGTGGGCTACATACGGCCGGAGGCCAACTTTTCGTCACTTGAAGCCTTGATAGCAAAAATTCACGAGGACAGGAAG
ATTGCAGAAAGAGCTCTCGAACTTCCTCAATACTTGAAGTACAAGGACGATCCATACCTTAAAAGTTCTCTGCATCAACAAAATTGA
Edits in Original Sequence 
(5')XGGAGTCCCCATTTCCCCATAACAACCAAGAAAAAGTTGAAGtGCTTCATCTTCTCAGTTCAATAATCAATTGGTGAAGTTGGATT
ATAAXTTGCTCTCCATGTCTGTTGAACGAACTTTCAAGAAGCTAGTTTCTGGTGTCATCCTTGATTTGGATGGTACACTTCTTAATACAG
ATGGCATTGTGAGTGAGATTTTAAAGGTTTTCTTAGTTAAGTATGGAAAGCAATGGGATGGGAGAGAAGCTCCCCACATAGTAGGGAAAA
CCCCAACAGAAGCTGCTGCTGCCGTTGTTGAAGATTATGGGCTGCCACTGTCAAGAGATGAATTTCTTTCGCAATTTTACCCAATGCTGT
CTGATCAGTGGCGCAATATCAAAGCTCTTCCAGGGGCCAATCGATTGATTAACCATTTGAGCGGTCATGGTGTACCCATGGCATTGGCGT
CAAATTCTTCTAAATCTAACATTGAGGCCAAAATTTTTCATCATGCAGGATGGAAAGAGTCCTTCTCAGCTATTGTTGGAGGAGATGAAG
TGAAAGCTGGAAAGCCGTCTCCGGAAATATTTCTTGAAGCAGCTAAAAGACTCAACATGGATCCATCCAGCTTTCTTGTCATTGAAGATT
CAATACCAGGTGTTACTGCTGGTAAAGATGCTGGAATGGCAGTAGTTGCTGTACCATCTCTTGCAAAGCAGTCTCATCTTTATACCTCTG
CTGATGAAGTGATCAATTCTCTTCTAGATTTGCAACTAGAAAAGTGGGGACTACCTGCATTTCAAGATAGGATAGAAGGTACTTTGCCTT
TAGAACCTTGGTATATAGGTGGTCCTGTCATTAAGGGATTTGGGCGCGGCTCAAAGGTTCTCGGGATCCCCACAGCTAATTTATCCCCAC
AAGGTTATTCAGCCATTCTTTCAGAACATCCAGCGGGTGTATATTTTGGATGGGCAGGACTATCAGGTCGAGGTGTCTACAAGATGGTCA
TGAGCATTGGTTGGAATCCTTTCTTCAACAATACAGAGAAGACGGTTGAACCATGGTTGCTTCATGACTTCAATGAGGACTTCTATGGTG
AGGAATTGCATCTAGTTGTTGTGGGCTACATACGGCCGGAGGCCAACTTTTCGTCACTTGAAGCCTTGATAGCAAAAATTCACGAGGACA
GGAAGATTGCAGAAAGAGCTCTCGAACTTCCTCAATACTTGAAGTACAAGGACGATCCATACCTTAAAAGTTCTCTGCATCAACAAAATT
GA(3')TCATTGAAGTGTTGAAGTTCATTATTGTTCTGATTGGGATTGTATCTGTTTATTCTGTCCTAATTCCTCAGACTACAATAGTCT
CCCCATCAAAATGCTCTATACAATAAAAAGATAAAAAGAATTTGAATGTATAGCTATTCAGAAGTTAAAGAACCTTCCAGGGGGTATTAG
TGAATGGCAAAGGGTTCAAGTGCAGGATCTTTGTACTGAGAATTTCAAGTTCCTGTGTAAATGTTGATTAATGTAACTTGTTTTCTATCT
GTTTATAATATGGAAACATGCAAGCTGATGCAGATTGTAAATTGCTTCCTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan