ESTScan Details for Unigene SGN-U572964

Score 
789
Direction 
Forward
Predicted Peptide Sequence 
XGSVESRPFAAICFCNRAAAHQALGQIVDAIADCSLAIALDKNYTKAVSRRATLHEMIRDYGHAVNDLERLISLQEAQSQERIRQSEALD
KSNGSSAKEAKRTRRQLSTIQEKAKRATPLDLYLILGIKSSDTESDIKKAYRKAALRHHPDKAGQILARSDAMDDGGLWKEISDTVRNDA
DRLFKLIGEAYAVLSNSDKRAKHDLEEEIREFKGKEGETAVLADLLILILLHLRGRTGHEDNLTFTVLHLVKVVVSTMDKSIGEPMENHI
PDGKRSKNLKMKDSLKSKGLVILFRDQMDSVFELCHRLGPDHAKQDTKFYLNDQFAPGHSAK
Predicted Coding Sequence 
XCAGGCAGTGTTGAGTCGCGCCCTTTTGCAGCTATCTGTTTCTGCAATCGAGCTGCTGCTCACCAAGCTCTTGGTCAAATTGTTGATGCC
ATAGCAGATTGCAGTCTTGCCATTGCTCTTGACAAGAACTACACGAAGGCTGTTTCAAGGAGGGCTACCTTACATGAGATGATTAGAGAC
TATGGGCATGCTGTAAATGATCTTGAGAGGCTCATATCCCTTCAGGAAGCTCAATCTCAAGAAAGGATTCGACAATCTGAGGCGCTGGAT
AAGTCAAATGGAAGTAGTGCTAAAGAAGCAAAGCGAACTCGTCGGCAGCTTTCGACAATTCAGGAGAAGGCTAAAAGAGCAACGCCATTG
GATCTTTATCTTATTTTGGGAATCAAGTCATCTGATACAGAATCTGACATCAAGAAGGCATATAGGAAAGCAGCCCTCAGACATCATCCT
GATAAGGCGGGTCAAATTTTGGCAAGGAGTGATGCCATGGATGATGGAGGGTTGTGGAAAGAGATCTCTGATACTGTCCGCAATGATGCT
GATAGGCTGTTCAAGTTGATTGGAGAAGCGTATGCAGTTCTCTCAAATTCCGACAAGCGTGCAAAACATGATTTAGAAGAAGAAATAAGG
GAGTTCAAAGGGAAAGAGGGAGAAACAGCGGTTCTTGCAGACCTTCTGATTCTTATTCTTCTCCATTTGAGAGGACGAACTGGTCACGAA
GACAATCTAACTTTTACAGTTCTCCATTTGGTAAAAGTAGTAGTAAGCACTATGGACAAGAGTATTGGAGAACCTATGGAGAATCACATC
CCAGATGGTAAAAGGTCGAAAAATTTGAAGATGAAGGATTCCTTGAAAAGTAAAGGATTAGTAATCCTTTTTAGAGATCAAATGGATTCG
GTCTTTGAGCTATGTCACAGATTGGGACCTGATCATGCTAAGCAAGACACAAAATTCTATCTCAATGACCAGTTTGCCCCTGGACATTCT
GCCAAG
Edits in Original Sequence 
(5')XCAGGCAGTGTTGAGTCGCGCCCTTTTGCAGCTATCTGTTTCTGCAATCGAGCTGCTGCTCACCAAGCTCTTGGTCAAATTGTTGA
TGCCATAGCAGATTGCAGTCTTGCCATTGCTCTTGACAAGAACTACACGAAGGCTGTTTCAAGGAGGGCTACCTTACATGAGATGATTAG
AGACTATGGGCATGCTGTAAATGATCTTGAGAGGCTCATATCCCTTCAGGAAGCTCAATCTCAAGAAAGGATTCGACAATCTGAGGCGCT
GGATAAGTCAAATGGAAGTAGTGCTAAAGAAGCAAAGCGAACTCGTCGGCAGCTTTCGACAATTCAGGAGAAGGCTAAAAGAGCAACGCC
ATTGGATCTTTATCTTATTTTGGGAATCAAGTCATCTGATACAGAATCTGACATCAAGAAGGCATATAGGAAAGCAGCCCTCAGACATCA
TCCTGATAAGGCGGGTCAAATTTTGGCAAGGAGTGATGCCATGGATGATGGAGGGTTGTGGAAAGAGATCTCTGATACTGTCCGCAATGA
TGCTGATAGGCTGTTCAAGTTGATTGGAGAAGCGTATGCAGTTCTCTCAAATTCCGACAAGCGTGCAAAACATGATTTAGAAGAAGAAAT
AAGGGAtGTTCAAAGGGAAAGAGGGAGAAACAGCGGTTCTTGCAGACCTTCTGATTCTTATTCTTCTCCATTTGAGAGGACGAACTGGTC
ACGAAGACAATCTAACTTTTACAGTTCTCCATTTGGTAAAAGTAGTAGTAAGCACTATGGACAAGAGTATTGGAGAACCTATGGAGAATC
ACATCCCAGATGGTAAAAGGTCGAAAAATTTGAAGATGAAGGATTCCTTGAAAAGTAAAGGATTAGTAATCCTTTTTAGAGATCAAATGG
ATTCGGTCTTTGAGCTATGTCACAGATTGGtGACCTGATCATGCTAAGCAAGACACAAAATTCTATCTCAATGACCAGTTTGCCCCTGGA
CATTCTGCCAAG(3')TTACATTTTTTTCCCCAAAGATGAAGCTTTTATTAGTTTGGCACCTGCTTGCCCAGTGGAGGTGTTGGAAAATT
TAGCAAAAAAAGGGGGTTTTATTTTCTTCCATTTTTGCCTTTAGAGTGGACCTTCACCTTGGAGTTTTGATGGGCAAATTGTAAATTAGC
CGAGTTTATCAGCATATAAAAGGAATAAGATCAAGTTTTGCTTATGCATATATGCAAGTGGTTAATTTGTTATCAACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan