ESTScan Details for Unigene SGN-U573012

Score 
180
Direction 
Forward
Predicted Peptide Sequence 
MCIYVRDNKSYEYWTTIELAVHHXLFLLFPPLQFSHHEPGVTHVLVTGGAGYIGSHAALRLLKDSYRVTIVDNL
Predicted Coding Sequence 
ATGTGTATATATGTGAGAGACAATAAATCATATGAATATTGGACAACTATTGAGCTTGCTGTTCACCATGXTTTGTTTCTCCTGTTTCCT
CCTCTTCAGTTCTCTCATCATGAACCAGGTGTCACTCATGTGTTAGTCACTGGAGGTGCTGGATATATTGGATCGCATGCAGCATTACGT
CTTCTAAAAGATTCTTACCGAGTGACCATAGTGGACAACCTT
Edits in Original Sequence 
GCCGTACTTGGTTTTGGTCGGTCATCATTTAGTGGGAAAAATTGGCTGTCATTTTTGTTGACAGATGTTTGGAACTGTACTTTTGTTTAC
TGGTTCATCATTTTTCTAGAAAGCTCGATAGTAGTATATTATTGCCTGCACTTGCCACTAAAATCTAGTTTTGGTATCTATCTTTGTTTT
TGGAACTTTTGGGATATGAATTATTATTATGCTGTTTCAGCTCTGAGTTTGTCATAGTTCCTTTGTTGTTTCATATTGCAAGAGCTTTCT
GTTGAGATAGAGCTAGTTTCACCTTTCTAACTGGTGTAGGCCTTGTAACAATCGTCTAGAATGATGGATTAACAATTTTGTCCTTTTGAG
TTAATAACATTTGAATCAGCACAAATGATGGATTTGAATCTCCAGTTCTACAAGAAATGCAAATCCTCCTTAAGAGTGAGAAAAAGGAAA
TTTGTGTACACCTCTCAGTTTCGCAATAATTTTATTTTCATAAC
(5')ATGTGTATATATGTGAGAGACAATAAATCATATGAATATTGG
ACAACTATTGAGCTTGCTGTTCACCATGXTTTGTTTCTCCTGTTTCCTCCTCTTCAGTTCTCTCATCATGAACCAGGTGTCACTCATGTG
TTAGTCACTGGAGGTGCTGGATATATTGGATCGCATGCAGCATTACGTCTTCTAAAAGATTCTTACCGAGTGACCATAGTGGACAACCTT
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan