Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U573112

Score 
276
Direction 
Forward
Predicted Peptide Sequence 
EKQEGGDTGGVNSNLYPTGLKNGGEPVDVNEFEELARQVLPKISYDFFSGGAEDQHTLKENIEAFHRIIIQPRILVDVSRIDMSTVILSH
KTSAPIMIAPTMMHKFAHPEGCTKSITPFISICLCGFXLDTTFKKVKKIFVSYYLKLKICRMYQKMFNLVLLNMSRAKIDLKTSQIRKEE
PTKKERRETNWNGEYLLGHLWLTDXYKPVIFMPGEIATARGAASCNVIAVIFSGKKRQILSNSGXLDAKFSWIPGLSFTFKAVRFIX
Predicted Coding Sequence 
GAAAAACAAGAAGGTGGAGATACTGGAGGCGTGAACTCTAATCTGTATCCTACGGGGCTAAAAAATGGAGGTGAACCAGTTGATGTGAAT
GAATTTGAAGAGCTAGCTAGGCAAGTTCTTCCAAAGATATCCTATGACTTCTTTTCTGGAGGAGCTGAGGACCAGCACACACTCAAAGAA
AATATTGAAGCATTTCATAGAATCATAATCCAGCCAAGAATACTTGTTGATGTGAGCAGAATAGACATGTCAACTGTTATACTCAGTCAC
AAGACGTCAGCTCCTATAATGATTGCCCCAACTATGATGCACAAATTTGCACACCCTGAAGGTTGTACTAAATCAATTACTCCATTCATT
TCAATTTGTTTGTGTGGTTTTGAXCTTGACACAACATTTAAGAAAGTAAAGAAGATTTTTGTGTCTTATTATCTTAAACTAAAGATATGT
AGAATGTACCAAAAGATGTTTAACCTTGTGCTTTTAAACATGTCACGTGCAAAGATAGACTTAAAGACTTCTCAAATAAGAAAAGAGGAA
CCGACTAAAAAGGAAAGAAGAGAAACAAATTGGAACGGAGAATATCTCCTTGGTCACTTATGGTTAACTGATXTCTACAAACCTGTTATA
TTTATGCCAGGAGAAATTGCAACAGCTAGAGGTGCTGCATCGTGTAATGTTATCGCGGTAATATTTTCTGGAAAAAAAAGACAGATTTTA
TCGAATTCTGGTGXTCTGGATGCTAAATTCTCTTGGATACCGGGATTGTCATTTACGTTTAAGGCTGTTCGCTTCATTCXX
Edits in Original Sequence 
(5')GtAAAAACAAGAAGGTGGAGATACTGGAGGCGTGAACTCTAATCTGTATCCTACGGGGCTAAAAAATGGcAGGTGAACCAGTTGAT
GTGAATGAATTTGAAGAGCTAGCTAGGCAAGTTCTTCCAAAGATATCCTATGACTTCTTTTCTGGAGGAGCTGAGGACCAGCACACACTC
AAAGAAAATATTGAAGCATTTCATAGAATCATAATCCAGCCAAGAATACTTGTTGATGTGAGCAGAATAGACATGTCAACTGTTATACTC
AGTCACAAGACGTCAGCTCCTATAATGATTGCCCCAACTATGATGCACAAATTTGCACACCCTGAAGGTTGTACTAAATCAATTACTCCA
TTCATTTCAATTTGTTTGTGTGGTTTTGAXCTTGACACAACATTTAAGAAAGTAAAGAAGATTTTTGTGTCTTATTATCTTAAACTAAAG
ATATGTAGAATGTACCAAAAGATGTTTAACCTTGTGCTTTTAAACATGTCACGTGCAAAGATAGACTTAAAGACTTCTCAAATAAGAAAA
GAGGAACCGACTAAAAAGGAAAGtAAGAGAAACAAATTGGAACGGAGAATATCTCCTTGGTCACTTATGGTTAACTGATXTCTACAAACC
TGTTATATTTATGCCAGGAGAAATTGCAACAGCTAGAGGTGCTGCATCGTGTAATGTTATCGCGGTAATATTTTCTGGAAAAAAAAGACA
GATTTTATCGAATTCTGGTGXTCTGGATGCTAAATTCTCTTGGATACCGGGATTGTCATTTACGTTTAAGGCTGTTCGCTTCATTCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan