Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U573178

Score 
509
Direction 
Forward
Predicted Peptide Sequence 
XILPYFLTLSITHNFIPTVPPPPWWVARDIHSPGVYFTINANSEVVMGQKLSCGQQSNEHGLFIAVQNGEVEKVEAMVDENPNVIRLKTL
RGKLSALHVAAVNGQIEVLCMLLDRGVNPDILNRHKQTPLMLAAMHGNVSCVERLIQLGANILMFDSLHGRTCLHYAAYHGHSDCLQSIL
ASAHSAPVAQSWGFARFVNIRDGSGATPLHLAARHGRPGCVRILLSNEXLVCASSGGYGRPGSTPLHLAXXXXFGX
Predicted Coding Sequence 
XXCATTTTACCTTACTTTTTAACACTTTCCATTACTCATAATTTCATCCCCACCGTCCCCCCTCCGCCGTGGTGGGTGGCGCGTGATATT
CACTCCCCGGGAGTTTACTTCACTATCAATGCTAACAGCGAGGTGGTGATGGGGCAGAAATTGAGCTGTGGACAGCAATCTAATGAACAT
GGATTGTTTATTGCAGTCCAAAATGGTGAGGTTGAAAAAGTTGAAGCTATGGTTGATGAAAATCCAAATGTGATTAGACTGAAAACTCTT
CGTGGGAAGCTTTCTGCACTTCATGTAGCTGCTGTTAATGGCCAGATCGAGGTTCTGTGTATGCTTTTGGATCGCGGAGTTAATCCAGAC
ATCTTGAATCGCCACAAACAGACCCCATTAATGTTAGCTGCTATGCATGGAAATGTGTCCTGCGTGGAGAGGCTAATTCAGCTAGGTGCT
AATATTTTAATGTTTGATTCACTACATGGAAGAACTTGTTTGCATTACGCTGCTTACCATGGCCACTCTGACTGCCTACAATCTATTCTT
GCATCCGCTCATTCGGCTCCTGTTGCTCAATCTTGGGGATTTGCGAGATTTGTGAACATAAGAGATGGAAGTGGTGCAACCCCATTGCAT
TTAGCAGCACGTCATGGTAGACCAGGATGTGTCCGGATTCTTCTAAGCAATGAGNCTCTTGTCTGTGCTTCTAGTGGNGGNTATGGCCGT
CCAGGAAGTACACCACTGCATTTAGCANCTGANAGNNTCTTTGGACXX
Edits in Original Sequence 
(5')XXCATTTTACCTTACTTTTTAACACTTTCCATTACTCATAATTTCAcTCCCCACCGTCCCCCCTCCGCCGTGGTGGGTGGCGCGTG
ATATTCACTCCCCGGGAGTTTACTTCACTATCAATGCTAACAGCGAGGTGGTGATGGGGCAGAAATTGAGCTGTGGACAGCAATCTAATG
AACATGGATTGTTTATTGCAGTCCAAAATGGTGAGGTTGAAAAAGTTGAAGCTATGGTTGATGAAAATCCAAATGTGATTAGACTGAAAA
CTCTTCGTGGGAAGCTTTCTGCACTTCATGTAGCTGCTGTTAATGGCCAGATCGAGGTTCTGTGTATGCTTTTGGATCGCGGAGTTAATC
CAGACATCTTGAATCGCCACAAACAGACCCCATTAATGTTAGCTGCTATGCATGGAAATGTGTCCTGCGTGGAGAGGCTAATTCAGCTAG
GTGCTAATATTTTAATGTTTGATTCACTACATGGAAGAACTTGTTTGCATTACGCTGCTTACCATGGCCACTCTGACTGCCTACAATCTA
TTCTTGCATCCGCTCATTCGGCTCCTGTTGCTCAATCTTGGGGATTTGCGAGATTTGTGAACATAAGAGATGGAAGTGGTGCAACCCCAT
TGCATTTAGCAGCACGTCATGGTAGACCAGGATGTGTCCGGATTCTTCTAAGCAATGAGNCTCTTGTCTGTGCTTCTAGTGGNGGNTATG
GCCGTCCAGGAAGTACACCACTGCATTTAGCANCTcGANAGNNTCTTTGGACXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan