ESTScan Details for Unigene SGN-U573183

Score 
627
Direction 
Forward
Predicted Peptide Sequence 
MGRGKIEIKRIENTNNRQVTYSKRRNGIIKKAKEITVLCEAKVSLIIFASSGKMHEYCSPSTTISDMLDGYQKASGRRLWDAKHENLSNE
IDRIKKENDSMQVKLRHLKGEDINQLTHKELIIMEEALQNGLSSISAKQSEILRMVRKNDQILEEENKQLQYALHQKEMGAIGGSGNMRG
IHEEVYHQRERDYEYQMPFGLRVQPMQPNLHERM*
Predicted Coding Sequence 
ATGGGGAGAGGTAAAATAGAGATAAAGAGAATAGAAAACACAAACAACAGGCAAGTAACTTATTCAAAAAGAAGAAATGGTATAATAAAG
AAAGCTAAAGAAATTACTGTTCTTTGTGAAGCTAAGGTTTCACTTATAATCTTTGCTAGTTCTGGAAAGATGCATGAATATTGTAGCCCT
TCTACTACGATAAGTGATATGTTGGATGGTTATCAAAAAGCTTCTGGGAGGAGACTATGGGATGCTAAGCATGAGAATTTGAGTAATGAA
ATTGATAGAATCAAGAAAGAGAATGACAGTATGCAGGTTAAGCTCAGGCACCTCAAAGGAGAAGATATCAATCAACTTACCCATAAAGAG
CTTATAATTATGGAAGAAGCCTTACAAAATGGACTTTCTAGTATCAGTGCCAAGCAGTCTGAAATCTTGAGGATGGTCAGGAAAAATGAT
CAAATTCTGGAGGAGGAAAATAAGCAACTTCAATATGCTTTGCACCAAAAGGAGATGGGAGCCATTGGTGGAAGTGGAAATATGAGAGGA
ATTCATGAAGAAGTGTATCATCAAAGAGAAAGGGATTATGAGTACCAAATGCCATTTGGCCTACGAGTTCAGCCAATGCAGCCAAATCTA
CATGAAAGAATGTAA
Edits in Original Sequence 
AAATACCATTCATTATTTTCCTCTATAAAAAAAAATCTTCAAACTTATTCAATTTCAAGAAGAAAAATTACTAGTAAGTGATCATC(5')
ATGGGGAGAGGTAAAATAGAGATAAAGAGAATAGAAAACACAAACAACAGGCAAGTAACTTATTCAAAAAGAAGAAATGGTATAATAAAG
AAAGCTAAAGAAATTACTGTTCTTTGTGAAGCTAAGGTTTCACTTATAATCTTTGCTAGTTCTGGAAAGATGCATGAATATTGTAGCCCT
TCTACTACGATAAGTGATATGTTGGATGGTTATCAAAAAGCTTCTGGGAGGAGACTATGGGATGCTAAGCATGAGAATTTGAGTAATGAA
ATTGATAGAATCAAGAAAGAGAATGACAGTATGCAGGTTAAGCTCAGGCACCTCAAAGGAGAAGATATCAATCAACTTACCCATAAAGAG
CTTATAATTATGGAAGAAGCCTTACAAAATGGACTTTCTAGTATCAGTGCCAAGCAGTCTGAAATCTTGAGGATGGTCAGGAAAAATGAT
CAAATTCTGGAGGAGGAAAATAAGCAACTTCAATATGCTTTGCACCAAAAGGAGATGGGAGCCATTGGTGGAAGTGGAAATATGAGAGGA
ATTCATGAAGAAGTGTATCATCAAAGAGAAAGGGATTATGAGTACCAAATGCCATTTGGCCTACGAGTTCAGCCAATGCAGCCAAATCTA
CATGAAAGAATGTAA(3')AATTATATTAATTCCCACTTTAAATTAAGAACTCTAATAATTTTAATTTGGGTTTCTACTATAGCTAGAAA
CACTAATTAATCAATTCTAGTTATATGTAATGAGTATTAGCTAAGACTTTGTTTCATGTTGGAATTATTACCTAATTTTATGGGCTCTTC
CCATGGTTTTAATTAAGTACTGAAATGTAGTGACATATTTATATGAATTGTTCTACTTACCTAGCTACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan