ESTScan Details for Unigene SGN-U573193

Score 
432
Direction 
Forward
Predicted Peptide Sequence 
XAPDLLLLFSNFSADCILKILNLIIVEDLRVFXMSTPLVVGTTIGAAALGARYLIRAWQRFKAAPRVRRFYPGGFDRDMTRREAALILGV
RESAVLQKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKGANSAF*
Predicted Coding Sequence 
XXCGCACCAGATCTTCTACTTCTTTTCTCAAATTTCTCAGCTGACTGCATATTGAAAATCCTGAATCTCATCATTGTTGAAGACTTGCGA
GTTTTCTXCATGTCAACTCCATTAGTTGTTGGAACTACCATTGGTGCTGCTGCTTTGGGAGCTAGATACTTGATAAGAGCGTGGCAAAGG
TTCAAAGCAGCACCCCGAGTGAGGAGGTTTTATCCTGGGGGCTTTGATCGGGATATGACACGGCGAGAAGCAGCATTGATTCTCGGAGTT
AGGGAAAGTGCTGTCTTGCAGAAGATCAAGGAGGCTCACAGGAGAGTAATGGTAGCAAATCATCCAGACGCCGGTGGCAGCCATTATCTT
GCTTCCAAGATCAATGAAGCCAAGGACGTGTTGTTAGGGAAAACCAAGGGAGCTAATTCTGCATTTTAA
Edits in Original Sequence 
(5')XXCGCACCAGATCTTCTACTTCTTTaTCTCAAATTTCTCAGCTGACTGCATATTGAAAATCCTGAATCTCATCATTGTTGAAGACT
TGCGAGTTTTCTXCATGTCAACTCCATTAGTTGTTGGAACTACCATTGGTGCTGCTGCTTTGGGAGCTAGATACTTGATAAGAGCGTGGC
AAAGGTTCAAAGCAGCACCCCGAGTGAGGAGGTTTTATCCTGGGGGCTTTGATCGGGATATGACACGGCGAGAAGCAGCATTGATTCTCG
GAGTTAGGGAAAGTGCTGTCTTGCAGAAGATCAAGGAGGCTCACAGGAGAGTAATGGTAGCAAATCATCCAGACGCCGGTGGCAGCCATT
ATCTTGCTTCCAAGATCAATGAAGCCAAGGACGTGTTGTTAGGGAAAACCAAGGGAGCTAATTCTGCATTTTAA(3')TTGACCAGTGTG
TTCTTTACGCTGCGAATTCTTAACAGCTTCATGATAGTCAACATTAAAATGGATCTTTTTCTGGGGAAAAGGAGAACATATTCTGTTTCG
AGTTAAGAGGTGAATTTGTATCAACAGCTGGGTGCATTACTGCCATAAATTTCATGTAATGCAACCAGAAATATTCTTTGCAGATTGTTT
ACAATAAAAAGTTGTATATTCCTGTTAACTATACTCTATTTGGAAACATTACTCGATCTGCATGTAGTATGTACGCAGTGGGTTCATCCC
ACCTACTGCTCGAAATGAACTAACTACATGCTGTACGCAGACAGAGAACACTGAATAATGCATCAACAAGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan