ESTScan Details for Unigene SGN-U573314

Score 
990
Direction 
Forward
Predicted Peptide Sequence 
VCGVRVSGYGASFCRRIVFDERRYKTARFDFKSSSSSTSQGLQKCSKKNLSRILRTEAAIRGIHRKANSEKYTNLWPKAVLKALDDAIRD
NRWDSALKIFDLLRKQHWYEPRCHTYAKLLVMLGKCKQPSQANLLFEIMLADGLQPTVDVYTALVNAYGLSGLLDEALRTIDDMKSVSNC
KPDVYTYSILIKCCTKVRRFDMIEYILAEMVYLGIECSSVTYNTIIDGYGKAKLFEQMECSLTDMIENETAFPDVFTLNSVIGSYGSCGK
LEEMEKWFEEFQVMGIKPDVMTFNILIKSYGRAGMYQKMECVLDFMRNWFYSPTVVTYNIIIETLGKACLIKNMEQFFLQMKHEGVKPSS
FTYCSLVSAYSRAALMENVDSIMRQVENSDVVLDTPFFNCIISAYGQVGDIERMVALFLEMKVRKCKPDYITFSTMIQAYNSQGMTEAAM
DLKTEMITSCESNEXDQQQYNLSATEGNRSLGILFINLNVVKVGRVLSACELKDDIEIR*
Predicted Coding Sequence 
GTTTGTGGAGTGAGAGTGAGTGGGTATGGAGCTTCATTTTGCAGGCGCATCGTATTTGATGAAAGAAGGTATAAAACGGCGAGGTTTGAT
TTCAAATCATCAAGCAGTAGTACTTCACAAGGGCTGCAGAAATGTTCAAAGAAAAACCTTTCTCGTATACTTAGAACAGAAGCCGCCATT
AGAGGTATCCACAGGAAAGCCAACTCAGAAAAATACACTAATCTTTGGCCCAAGGCCGTTCTGAAGGCTCTCGATGATGCTATTAGGGAC
AATCGCTGGGACTCTGCTCTTAAGATTTTCGACCTTCTTCGCAAGCAACATTGGTATGAGCCAAGATGCCATACATATGCTAAGCTTTTG
GTAATGCTCGGCAAGTGCAAGCAGCCAAGTCAAGCTAACTTGCTTTTTGAGATTATGCTAGCGGATGGGCTTCAACCAACAGTAGATGTT
TATACTGCACTTGTAAATGCATATGGTCTTAGTGGCCTCCTTGATGAGGCTCTGCGAACTATTGATGATATGAAATCAGTTAGTAATTGC
AAGCCTGATGTGTATACTTACTCGATCCTAATTAAATGCTGCACTAAAGTTCGTCGTTTTGATATGATTGAATACATTTTGGCTGAGATG
GTGTATTTGGGAATTGAATGTAGTTCTGTGACATACAATACCATAATTGATGGCTATGGTAAAGCTAAGCTATTTGAGCAGATGGAATGC
TCCTTGACCGATATGATAGAAAATGAGACTGCCTTTCCAGATGTTTTCACCTTGAATTCAGTAATTGGGTCCTATGGCAGCTGTGGGAAG
CTTGAGGAAATGGAGAAGTGGTTTGAAGAATTTCAGGTAATGGGAATAAAGCCAGATGTTATGACATTTAACATTTTAATCAAGTCATAT
GGAAGAGCTGGCATGTACCAGAAAATGGAGTGTGTACTTGATTTCATGAGGAATTGGTTCTATTCTCCAACAGTTGTGACTTACAATATC
ATCATTGAGACATTGGGGAAAGCTTGCCTCATTAAGAACATGGAACAGTTTTTCCTACAGATGAAGCATGAAGGGGTGAAGCCAAGTTCA
TTCACTTATTGCTCTCTTGTCAGTGCGTATAGTAGAGCTGCACTTATGGAAAATGTTGATTCAATCATGAGGCAAGTTGAGAATTCAGAT
GTAGTTCTAGATACTCCTTTTTTCAATTGCATCATCAGTGCTTACGGTCAAGTTGGTGATATAGAGAGGATGGTGGCATTGTTCTTGGAA
ATGAAGGTCAGAAAATGTAAACCAGACTACATCACATTTTCTACCATGATTCAGGCGTACAATTCACAAGGAATGACTGAAGCTGCAATG
GACTTGAAGACAGAAATGATTACTTCTTGTGAATCAAATGAAXTTGATCAGCAGCAGTACAATCTATCTGCTACCGAAGGGAACCGTTCA
CTTGGAATTCTGTTCATCAATCTCAATGTTGTGAAAGTGGGCAGAGTGTTATCTGCATGTGAGCTTAAGGATGATATAGAAATCCGTTAA
Edits in Original Sequence 
(5')GTTTGTGGAGTGAGAGTGAGTGGGTATGGAGCTTCATTTTGCAGGCGCATCGTATTTGATGAAAGAAGGTATAAAACGGCGAGGTT
TGATTaTCAAATCATCAAGCAGTAGTACTTCACAAGGGCTGCAGAAATGTTCAAAGAAAAACCTTTCTCGTATACTTAGAACAGAAGCCG
CCATTAGAGGTATCCACAGGAAAGCCAACTCAGAAAAATACACTAATCTTTGGCCCAAGGCCGTTCTGAAGGCTCTCGATGATGCTATTA
GGGACAATCGCTGGGACTCTGCTCTTAAGATTTTCGACCTTCTTCGCAAGCAACATTGGTATGAGCCAAGATGCCATACATATGCTAAGC
TTTTGGTAATGCTCGGCAAGTGCAAGCAGCCAAGTCAAGCTAACTTGCTTTTTGAGATTATGCTAGCGGATGGGCTTCAACCAACAGTAG
ATGTTTATACTGCACTTGTAAATGCATATGGTCTTAGTGGCCTCCTTGATGAGGCTCTGCGAACTATTGATGATATGAAATCAGTTAGTA
ATTGCAAGCCTGATGTGTATACTTACTCGATCCTAATTAAATGCTGCACTAAAGTTCGTCGTTTTGATATGATTGAATACATTTTGGCTG
AGATGGTGTATTTGGGAATTGAATGTAGTTCTGTGACATACAATACCATAATTGATGGCTATGGTAAAGCTAAGCTATTTGAGCAGATGG
AATGCTCCTTGACCGATATGATAGAAAATGAGACTGCCTTTCCAGATGTTTTCACCTTGAATTCAGTAATTGGGTCCTATGGCAGCTGTG
GGAAGCTTGAGGAAATGGAGAAGTGGTTTGAAGAATTTCAGGTAATGGGAATAAAGCCAGATGTTATGACATTTAACATTTTAATCAAGT
CATATGGAAGAGCTGGCATGTACCAGAAAATGGAGTGTGTACTTGATTTCATGAGGAATTGGTTCTATTCTCCAACAGTTGTGACTTACA
ATATCATCATTGAGACATTGGGGAAAGCTTGCCTCATTAAGAACATGGAACAGTTTTTCCTACAGATGAAGCATGAAGGGGTGAAGCCAA
GTTCATTCACTTATTGCTCTCTTGTCAGTGCGTATAGTAGAGCTGCACTTATGGAAAATGTTGATTCAATCATGAGGCAAGTTGAGAATT
CAGATGTAGTTCTAGATACTCCTTTTTTCAATTGCATCATCAGTGCTTACGGTCAAGTTGGTGATATAGAGAGGATGGTGGCATTGTTCT
TGGAAATGAAGGTCAGAAAATGTAAACCAGACTACATCACATTTTCTACCATGATTCAGGCGTACAATTCACAAGGAATGACTGAAGCTG
CAATGGACTTGAAGACAGAAATGATTACTTCTTGTGAATCAAATGAAXTTGATCAGCAGCtAGTACAATCTATCTGCTACCGAAGGGAAC
CGTTCACTTGGAATTCTGTTCATCAATCTCAATGTTGTGAAAGTGGGCAGAGTGTTATCTGCATGTGAGCTTAAGGATGATATAGAAATC
CGTTAA(3')TCAGATGGCATGGATCCAAGGAAAAGAACATTGTGAGTCTACTTGCAGCAATGTGATTTCTCTTACATATTTCTGTGAAC
TTTCGACGGCCTTAACCCACAACTAGAGAGATTTGCAGTTTCCAAAAGCTCTTGTTAGTTGTTAGGGAATAGTGTGGTTTAACTTCTCTG
AGTAGCTTTCCAGTTTGTTTGCCTATGTATGTTATTTCTTGATTTCTTTTTTTCTTGTATTAGCATATGTATCTACAGGTAAGAGAGGGA
GGGAGCAGTTAAAGTTCTTCTGCTTACTATGTTCACGGAACAGCCAAACGTGCTGTGATGTCTGTAGTTACAACCTGTGGGTTCATATTC
AGTTGAAAACCTCAGTTATGCTTGGGTGAATGAAGATTTTATCAGTAGTGGGTGATTACGATGGATAATTAACTCCTCGGTTACATTGAG
GGTCTACACTATTTCAGCTGCCACTGTGGGGTTGTCTACTGCAGTACTAATAGTCATGCAGCAAGGCCTTTTTTTTTACTAACCAGAGCT
GACTCAACCATACATATGGGTTTTGAACAGGTCAGTGATTTAACAGGACTGACTTCTTTCGAAAGAGCAAAGCCATGGGAAAGATAGAGC
ATTATTAGGACACTTGCTGATTCTTCCTTCTAGTCGGTTTGTTTTACCTCTTACTGGTTGCAAGTCTTGCGCAACAGATATATAGAGCAA
TATAGTGTAAGATAGTTTTACCATTTTTCAGACCCTCGCCATTTCACTTGTTACTGTGGAAATGAATTACAGCATTATGTTTGATAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan