ESTScan Details for Unigene SGN-U573324

Score 
-74
Direction 
Reverse
Predicted Peptide Sequence 
XCLPQMGVYDSIWVMLKADQVCSLHSVSDVVYGRKVSRAIYQSDCSNTWSSYFYHIRSRFTIYISILEGITTWSVYSVRYEYNISPQTDG
QSERTMQVLEDMLRACVIDFGARWDQHLSLAEFGYNNSYHSSIHMAPFEALYGRRCRSPIGWFDSAKMDSLDTNLLRDAXVASPYDSVDY
XTVQSRQSYADQGIRALVFMEGDHVWLRVSPMKGVMRFGKKGKFSPRFIGPFEILSRVGEELVVHPVFHVSMLRKFISDESHVLSLD
Predicted Coding Sequence 
XTTTGCCTACCACAAATGGGTGTTTATGACTCTATTTGGGTTATGTTGAAGGCTGACCAAGTCTGCTCACTTCATTCCGTTTCGGATGTA
GTATACGGCAGAAAAGTTAGTCGAGCTATATATCAGTCAGATTGTTCGAATACATGGAGTTCGTATTTTTATCATATCAGATCGAGGTTC
ACTATTTACATCTCAATTCTTGAAGGCATTACAACATGGTCTGTGTACTCAGTTAGATATGAGTACAACATTTCCCCTCAAACAGATGGT
CAATCTGAGCGGACCATGCAAGTATTGGAAGATATGCTTCGAGCGTGTGTGATCGATTTTGGTGCTAGATGGGATCAACATTTATCCTTA
GCGGAGTTTGGCTATAATAACAGTTATCACTCTAGTATCCATATGGCCCCATTTGAGGCGTTGTATGGAAGACGGTGTAGGTCTCCGATT
GGTTGGTTTGATTCGGCGAAGATGGACTCTTTGGATACAAACTTGCTTAGAGATGCTXATGTAGCAAGTCCGTATGATTCAGTAGATTAT
XTGACAGTTCAGAGTCGACAGAGTTATGCAGATCAGGGAATTAGAGCCTTAGTGTTTATGGAGGGTGATCATGTTTGGCTCCGAGTATCA
CCCATGAAGGGTGTGATGAGGTTTGGAAAAAAGGGCAAGTTTAGCCCTAGATTCATTGGACCTTTTGAGATTTTGAGCCGAGTAGGAGAG
GAGCTTGTAGTTCATCCTGTTTTTCATGTCTCTATGCTTCGGAAGTTTATTTCGGATGAATCTCATGTGCTTTCACTTGAC
Edits in Original Sequence 
(5')XTTTGCCTACCACAAATGGGTGTTTATGACTCTATTTGGGTTATGTTGAtAGGCTGACCAAGTCTGCTCACTTCATTCCGTTTCGG
ATGTAGTATACGGCAGAAAAGTTAGTCGAGCTATATATCAGTCAGATTGTTCGAATACATGGAGTTCGTATTTTTATCATATCAGATCGA
GGTTCACTATTTACATCTCAATTCTTGAAGGCATTACAACATGGTCTGTGTACTCAGTTAGATATGAGTACAACATTTCaCCCTCAAACA
GATGGTCAATCTGAGCGGACCATGCAAGTATTGGAAGATATGCTTCGAGCGTGTGTGATCGATTTTGGTGCTAGATGGGATCAACATTTA
TCCTTAGCGGAGTTTGGCTATAATAACAGTTATCACTCTAGTATCCATATGGCCCCATTTGAGGCGTTGTATGGAAGACGGTGTAGGTCT
CCGATTGGTTGGTTTGATTCGGCGAAGATGGACTCTTTGGATACAAACTTGCTTAGAGATGCTXATGTAGCAAGTCCGTATGATTCAGTA
GATTATXTGACAGTTCAGAGTCGACAGAGTTATGCAGATCAGGGAATTAGAGCCTTAGTGTTTATGGAGGGTGATCATGTTTGGCTCCGA
GTATCACCCATGAAGGGTGTGATGAGGTTTGGAAAAAAGGGCAAGTTTAGCCCTAGATTCATTGGACCTTTTGAGATTTTGAGCCGAGTA
GGAGAGGtAGCTTGTAGTTCATCCTGTTTTTCATGTCTCTATGCTTCGGAAGTTTATTTCGGATGAATCTCATGTGCTTTCACTTGAC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan