ESTScan Details for Unigene SGN-U573343

Score 
994
Direction 
Forward
Predicted Peptide Sequence 
MGDCLVVHTDRIVKANGAEIMDGKNPEMVGSSSAIAVDEKKVLEEEEEEEGDEEVPLIGRAECRICQEEDSLDKLESPCACSGSLKYTTE
HAFNTGANEKGDITCEICHQQYQPGYTVPPRPVAEETIIDIGGGWQISGTPLNLHDPRVLAIAEAERQLLEAEYDDYNSANASGAAFFRS
AALILMALLLLRHALPMTDTDGDDEDPTAFFSLFFSGQLAFFYPATSCSGPSASCSSADKXEEAAALAATQFAVVLHSGQPRSVQFTIAS
AAPATPAAPASVDNV*
Predicted Coding Sequence 
ATGGGAGATTGTTTGGTGGTGCATACGGATCGTATTGTGAAGGCTAATGGAGCTGAGATTATGGATGGGAAGAATCCTGAAATGGTAGGG
TCTTCGTCGGCAATAGCTGTAGATGAGAAGAAGGTGCTGGAGGAGGAGGAGGAGGAGGAGGGTGATGAGGAGGTGCCGTTAATTGGTAGA
GCAGAGTGCAGGATTTGCCAGGAGGAGGATTCTTTGGACAAGTTGGAGAGCCCATGTGCTTGCAGTGGAAGTCTCAAGTACACCACCGAG
CATGCGTTCAACACTGGTGCXAATGAGAAGGGGGATATTACTTGTGAGATTTGCCATCAGCAATACCAGCCTGGTTACACTGTTCCTCCT
CGACCTGTGGCTGAGGAGACAATTATTGATATTGGGGGAGGATGGCAAATCTCTGGTACCCCTTTGAATTTACATGATCCTCGCGTCTTG
GCAATTGCAGAGGCTGAACGCCAACTTCTGGAAGCTGAATATGATGATTACAATTCTGCAAATGCAAGTGGTGCAGCTTTCTTTCGATCG
GCTGCTTTAATTTTGATGGCTCTTCTACTATTGCGCCATGCATTACCAATGACAGATACAGATGGAGATGATGAAGATCCAACTGCTTTC
TTTTCGCTTTTCTTCTCCGGGCAGTTGGCTTTCTTTTACCCTGCTACATCATGCTCTGGGCCATCAGCATCTTGCAGCAGCGCAGACAAA
GAXGAGGAAGCTGCAGCATTGGCAGCAACACAATTTGCAGTTGTGTTACACTCTGGACAGCCGAGAAGTGTACAGTTTACCATAGCTTCA
GCTGCACCAGCAACACCAGCAGCGCCTGCTTCAGTGGATAATGTTTAA
Edits in Original Sequence 
CTTAGACCAAAAAAGTGTAGAAAACAACAAACAAACCGCAATAGTTTGGTATTTTTTTCGGAAAAATCTAAGATAAATACTATAATTTAG
CAAACACCCTTCAATTTGTTCCGCTATAAATCCGCAGAAATTTTTGGGTTTTTTTCTTTCTCTTTCCATTTGCTGAATTTCTTCATTTTC
CCAGGAATTGTGTTACTTTTTTTATCTGGGTTTTTACA
(5')ATGGGAGATTGTTTGGTGGTGCATACGGATCGTATTGTGAAGGCTAAT
GGAGCTGAGATTATGGATGGGAAGAATCCTGAAATGGTAGGGTCTTCGTCGGCAATAGCTGTAGATGAGAAGAAGGTGCTGGAGGAGGAG
GAGGAGGAGGAGGGTGATGAGGAGGTGCCGTTAATTGGTAGAGCAGAGTGCAGGATTTGCCAGGAGGAGGATTCTTTGGACAAGTTGGAG
AGCCCATGTGCTTGCAGTGGAAGTCTCAAGTACACaCACCGAGCATGCGTTCAACACTGGTGCXAATGAGAAGGGGGATATTACTTGTGA
GATTTGCCATCAGCAATACCAGCCTGGTTACACTGTTCCTCCTCGACCTGTGGCTGAGGAGACAATTATTGATATTGGGGGAGGATGGCA
AATCTCTGGTACCCCTTTGAATTTACATGATCCTCGCGTCTTGGCAATTGCAGAGGCTGAACGCCAACTTCTGGAAGCTGAATATGATGA
TTACAATTCTGCAAATGCAAGTGGTGCAGCTTTCTTTCGATCGGCTGCTTTAATTTTGATGGCTCTTCTACTATTGCGCCATGCATTACC
AATGACAGATACAGATGGAGATGATGAAGATCCAACTGCTTTCTTTTCGCTTTTCTTaCTCCGGGCAGTTGGCTTTCTTTTACCCTGCTA
CATCATGCTCTGGGCCATCAGCATCTTGCAGCAGCGCAGACAAAGAXGAGGAAGCTGCAGCATTGGCAGCAACACAATTTGCAGTTGTGT
TACACTCTGGACAGCCGAGAAGTGTACAGTTTACCATAGCTTCAGCTGCACCAGCAACACCAGCAGCGCCTGCTTCAGTGGATAATGTTT
AA(3')ACAACAAGATGATCGTGCTTGATCTCTTATTTTGAAGCTAAATACTGCCTTATGCTAGATTTGTTTGTCTGTTATCATATTTCA
TATATTATTATATGGGGAAGTTCGAAAATGAATTGTTGTATTACCATTTTGCCCCCCTTTACTGTTTTAAAAATTTGATTAAATATAAAT
ATTTTTAATTATATAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan