ESTScan Details for Unigene SGN-U573391

Score 
140
Direction 
Forward
Predicted Peptide Sequence 
MWYTAIIPNSKTTNFESASIQVDSSSSTTNVNLRIXINLVQKSVGRLVPTPTTYPDEXPLRETGFQHEAERGNSDQWSQTETFVWNICKK
LKSSAECRMRYSFCFPFFTKDYYIFFISMHGNVLYPKNQAYVTQDETLLATLTVQEAVYYSAQLQLPVSMTKSEKKQIAEQTIKEMGLQD
AMNTRIGGFGNKGISGGEKRRLSVCXGDSNAAKTSFPDEPTSGLDSAASYYVMSGISRQREGRTIIASIHQPSAEVFNLFHSFAFCLQEE
PYISDLIIGSIEIRLANHSLEVEDRSTLSSNSRRMRRNLSPNSMIEFRRELHNKSSXNEKAQKSEDMDKKD*
Predicted Coding Sequence 
ATGTGGTATACTGCTATTATTCCAAACTCGAAAACAACAAATTTTGAATCTGCATCCATTCAAGTAGATTCTTCGTCCTCTACTACAAAT
GTTAACCTCCGCATTCXGATCAATTTAGTTCAAAAATCAGTTGGTCGATTAGTGCCAACCCCTACTACATATCCTGATGAAXCACCTCTC
AGGGAGACTGGATTTCAGCACGAGGCAGAGCGGGGAAATTCTGATCAATGGTCACAAACAGAAACTTTCGTATGGAACATCTGTAAGAAA
TTAAAATCTTCAGCTGAATGCCGCATGCGCTACTCATTTTGTTTTCCTTTTTTCACAAAAGATTACTATATTTTTTTTATTAGCATGCAT
GGTAATGTTCTTTATCCTAAAAATCAGGCATATGTGACTCAAGATGAAACTCTGTTAGCAACACTAACAGTTCAAGAAGCAGTTTACTAC
TCTGCACAACTCCAACTCCCAGTTTCCATGACAAAATCAGAGAAAAAACAAATAGCAGAGCAGACTATTAAGGAGATGGGGTTGCAAGAT
GCAATGAACACAAGAATTGGAGGATTTGGTAATAAAGGAATTAGTGGAGGAGAAAAGAGAAGACTTAGTGTTTGCAXTGGAGATTCTAAC
GCGGCCAAAACTTCTTTTCCTGATGAACCAACCAGCGGCCTCGACAGTGCTGCATCTTATTACGTGATGAGCGGAATTTCACGTCAAAGA
GAGGGAAGAACCATTATTGCATCTATCCATCAGCCAAGTGCTGAAGTTTTCAACCTTTTCCACAGTTTTGCCTTCTGTCTTCAGGAAGAA
CCGTATATTTCGGACCTGATTATCGGATCAATCGAAATCAGACTGGCGAACCATAGCTTAGAAGTAGAAGATAGGTCAACACTTTCCTCT
AACTCTCGAAGAATGAGACGAAACCTGAGCCCTAATTCCATGATCGAATTCAGAAGAGAACTCCATAACAAGAGTAGCXGTAACGAAAAA
GCGCAGAAATCTGAGGACATGGATAAAAAAGATTAA
Edits in Original Sequence 
ATCAAAAAATTTCACTAAAAAAATAAAAATTGTAACATATTTCGTTGTCCCTTACACTAAACAAG(5')ATGTGGTATACTGCTATTATT
CCAAACTCGAAAACAtACAAATTTTGAATCTGCATCCATTCAAGTAGATTcCTTCGTCCTCTACTACAAATGTTAACCTCCGCATTCXGA
TCAATTTAGTTCAAAAATCAGTTcGGTCGATTAGTGCCAACCCCTACTACATATaCCTGATGAAXCACCTCTCAGGGAGACTGGATTTCA
GCACGAGGCAGAGCGGGGAAATTCTGATCAATGGTCACAAACAGAAACTTTCGTATGGAACATCTGTAAGAAATTAAAATCTTCAGCTGA
ATGCCGCATGCGCTACTCATTTTGTTTTCCTTTTTTCACAAtAAGATTACTATATTTTTTTTATTAGCATGCATGGTAATGTTCTTTATC
CTAtAAAATCAGGCATATGTGACTCAAGATGAAACTCTGTTAGCAACACTAACAGTTCAAGAAGCAGTTTACTACTCTGCACAACTCCAA
CTCCCAGTTTCCATGACAAAATCAGAGAAAAAACAAATAGCAGAGCAGACTATTAAGGAGATGGGGTTGCAAGATGCAATGAACACAAGA
ATTGGAGGATTTGGTAATAAAGGAATTAGTGGAGGAGAAAAGAGAAGACTTAGTGTTTGCAXTGGAGATTCTAACGCGGCCAAAACTTCT
TTTCCtTGATGAACCAACCAGCGGCCTCGACAGTGCTGCATCTTATTACGTGATGAGCGGAATTTCACGTCAAAGAGAGGGAAGAACCAT
TATTGCATCTATCCATCAGCCAAGTGCTGAAGTTTTCAACCTTTTCCACAGTTTaTGCCTTCTGTCTTCAGGAAGAACCGTATATTTCGG
ACCTGATTATCGGATCAATCGAAATCAGACTGGCGAACCATAGCTTAGAAGTAGAAGATAGGTCAACACTTTCCTCTAACTCTCGAAGAA
TGAGACGAAACCTGAGCCCTAATTCCATGATCGAATTCAGAAGAGAACTCCATAACAAGAGTAGCXGTAACGAAAAAGCGCAGAAATCTG
AGGACATGGATAAAAAAGATTAA(3')ATGTCAACCATTGCTAAACGAAAATAGCAAATTGTTTATATTTTTTGTTTGTTTAGCGCAATG
CAACCTGCAGCCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan