ESTScan Details for Unigene SGN-U573418

Score 
474
Direction 
Forward
Predicted Peptide Sequence 
MKGGTVQINWHDSKPVLCLDFHHLTGVIATGGADYDIKMWVIDSEENEKKAPSVTYQASLSYHSGAVNALRFSPSGEHLASGADGGELII
WKLHSSDDSKTWKVLKTLSFHRKDVLDLQWSADGSFLISGSVDNSCIVWDVNKGSVHQILDAHLHYVQGVAWDPLSKYTASLSSDRSCRI
YSNRPSKTKGVEKLNFVCQHVIX
Predicted Coding Sequence 
ATGAAGGGTGGTACAGTTCAGATCAATTGGCACGACAGTAAGCCAGTTTTGTGCCTTGATTTTCACCACCTCACCGGCGTTATTGCTACT
GGTGGCGCCGACTATGATATCAAGATGTGGGTGATTGATTCTGAAGAAAATGAAAAGAAAGCGCCTTCAGTTACATACCAGGCTAGCCTT
TCTTACCATAGTGGTGCTGTGAATGCTCTTCGGTTCTCCCCTTCAGGAGAGCATTTGGCCTCTGGTGCCGATGGCGGCGAGCTCATCATT
TGGAAGCTACATTCTTCAGATGACAGCAAAACATGGAAAGTCCTAAAGACGTTATCATTTCACCGGAAGGATGTATTGGACTTGCAGTGG
TCTGCTGATGGTTCTTTTTTAATTTCTGGTTCTGTTGATAATTCATGCATCGTATGGGATGTCAACAAAGGTTCTGTTCATCAGATTTTG
GATGCTCATTTGCACTATGTGCAAGGTGTGGCATGGGATCCATTGTCCAAGTATACTGCCTCACTCAGTTCAGATAGATCTTGCCGGATT
TACAGCAATAGACCATCTAAAACAAAAGGAGTTGAGAAGTTGAATTTTGTGTGTCAACATGTCATTAXX
Edits in Original Sequence 
TTTTCAACCAAAATCACCATTTCTCTAAACCCTATTTTCTTCTTCTTCTCTTGCATTTTTCCAAAATCTCAAAAATTAGTAAGAAGAGAG
ATCAGGAAGCAACAAATAAGG
(5')ATGAAGGGTGGTACAGTTCAGATCAATTGGCACGACAGTAAGCCAGTTTTGTGCCTTGATTTTCA
CCACCTCACCGGCGTTATTGCTACTGGTGGCGCCGACTATGATATCAAGATGTGGGTGATTGATTCTGAAGAAAATGAAAAGAAAGCGCC
TTCAGTTACATACCAGGCTAGCCTTTCTTACCATAGTGGTGCTGTGAATGCTCTTCGGTTCTCCCCTTCAGGAGAGCATTTGGCCTCTGG
TGCCGATGGCGGCGAGCTCATCATTTGGAAGCTACATTCTTCAGATGACAGCAAAACATGGAAAGTCCTAAAGACGTTATCATTTCACCG
GAAGGATGTATTGGACTTGCAGTGGTCTGCTGATGGTTCTTTTTTAATTTCTGGTTCTGTTGATAATTCATGCATCGTATGGGATGTCAA
CAAAGGTTCTGTTCATCAGATTTTGGATGCTCATTTGCACTATGTGCAAGGTGTGGCATGGGATCCATTGTCCAAGTATACTGCCTCACT
CAGTTCAGATAGATCTTGCCGGATTTACAGCAATAGACCATCTAAAACAAAAGGAGTTGAGAAGTTGAATTTTGTGTGTCAACATGTCAT
TAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan