ESTScan Details for Unigene SGN-U573461

Score 
346
Direction 
Forward
Predicted Peptide Sequence 
XGTPQFGGSAKAKDALWQRMSGCMDQLHSIVVAVWHLQRVLSKKRDPFTHVLLLDEVMQEGDPILTDRVWEALGKSFANQMKSTFSTSSF
VKEIFTLGYPKLFSMLENLLERISRDTDVKGVPPALSSEAKDQMLSSIEIFQTAFLTLCLSRLSELVNTVFPVSGRGTVPSKDHIARIIS
RIQEEIEAVQMDAQLTLLVLREINKVLLLLSERTEYQISAGPEARQITGPATPAQVKNFALCQHLQEIHTRISSMVAGLPAIATDILSPA
LGSIYGVAGDSVTPLX
Predicted Coding Sequence 
XGTGGGACACCACAGTTTGGGGGAAGTGCAAAGGCGAAGGATGCATTATGGCAAAGGATGAGTGGTTGTATGGACCAATTGCATTCCATT
GTGGTTGCTGTTTGGCATTTGCAGAGGGTTTTATCGAAGAAAAGAGACCCCTTTACGCATGTCTTGCTGCTTGATGAGGTCATGCAGGAA
GGTGATCCGATATTGACGGATCGTGTTTGGGAGGCACTGGGTAAATCTTTTGCTAACCAAATGAAGTCCACTTTCAGCACATCAAGTTTT
GTTAAGGAGATATTCACTCTTGGATATCCAAAACTCTTCTCTATGTTAGAAAACCTGCTTGAAAGAATTTCACGTGATACAGACGTCAAA
GGAGTTCCACCAGCTCTCAGTTCAGAAGCAAAGGACCAAATGTTATCTTCCATTGAAATATTCCAGACTGCTTTCCTAACCCTCTGTCTG
AGCCGTCTTTCAGAACTTGTTAATACTGTATTTCCAGTGTCCGGTCGTGGAACTGTTCCTTCAAAAGATCACATAGCAAGGATTATATCA
CGAATTCAAGAAGAAATAGAAGCCGTCCAGATGGATGCTCAGTTAACTCTTCTTGTCTTGCGTGAGATCAACAAAGTTCTGCTTCTGCTT
TCAGAAAGAACAGAATACCAGATATCTGCAGGTCCCGAGGCACGACAGATAACAGGTCCTGCAACTCCAGCACAGGTGAAGAACTTTGCG
TTATGCCAGCATCTGCAAGAAATTCATACCCGCATATCGTCTATGGTGGCAGGATTACCAGCTATTGCAACCGATATTTTGTCTCCCGCA
CTGGGATCTATCTATGGGGTTGCAGGTGATTCAGTGACACCACTATTX
Edits in Original Sequence 
(5')XGTGGGACACCACAGTTTGGGGGAAGTGCAAAGGCGAAGGATGCATTATGGCAAAGGATGAGTGGTTGTATGGACCAATTGCATTC
CATTGTGGTTGCTGTTTGGCATTTGCAGAGGGTTTTATCGAAGAAAAGAGACCCCTTTACGCATGTCTTGCTGCTTGATGAGGTCATGCA
GGAAGGTGATCCGATATTGACGGATCGTGTTTGGGAGGCACTGGGTAAATCTTTTGCTAACCAAATGAAGTCCACTTTCAGCACATCAAG
TTTTGTTAAGGAGATATTCACTCTTGGATATCCAAAACTCTTCTCTATGTTAGAAAACCTGCTTGAAAGAATTTCACGTGATACAGACGT
CAAAGGAGTTCCACCAGCTCTCAGTTCAGAAGCAAAGGACCAAATGTTATCTTCCATTGAAATATTCCAGACTGCTTTCCTAACCCTCTG
TCTGAGCCGTCTTTCAGAACTTGTTAATACTGTATTTCCAGTGTCCGGTCGTGGAACTGTTCCTTCAAAAGATCACATAGCAAGGATTAT
ATCACGAATTCAAGAAGAAATAGAAGCCGTCCAGATGGATGCTCAGTTAACTCTTCTTGTCTTGCGTGAGATCAACAAAGTTCTGCTTCT
GCTTTCAGAAAGAACAGAATACCAGATATCTGCAGGTCCCGAGGCACGACAGATAACAGGTCCTGCAACTCCAGCACAGGTGAAGAACTT
TGCGTTATGCCAGCATCTGCAAGAAATTCATACCCGCATATCGTCTATGGTGGCAGGATTACCAGCTATTGCAACCGATATTTTGTCTCC
CGCACTGGGATCTATCTATGGGGTTGCAGGTGATTCAGTGACACCACTATTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan