ESTScan Details for Unigene SGN-U573515

Score 
115
Direction 
Reverse
Predicted Peptide Sequence 
RNRTTVIVAHRTSTIKDADQISVLQDGKIVDQGTHSALIENRDGAYFKLIHLQQQQQQ*
Predicted Coding Sequence 
CGAAACAGGACTACTGTCATCGTGGCACATCGAACATCCACCATAAAAGATGCAGATCAGATATCTGTTTTACAAGATGGGAAAATCGTC
GATCAAGGGACTCACTCTGCATTGATAGAGAACAGAGATGGAGCATACTTTAAGCTAATTCACTTACAGCAACAGCAGCAACAGTAA
Edits in Original Sequence 
(5')CGAAACAGGACTACTGTCATCGTGGCACATCGAACtATCCACCATAAAAGATGCAGATCAGATATCTGTTTTACAAGATGGGAAAA
TCGTCGATCAAGGGACTCACTCTGCATTGATAGAGAACAGAGATGGAGCATACTTTAAGCTAATTCACTTACAGCAACAGCAGCAACAGT
AA(3')TAGCACCCCAACATACTTGGAGATGTTTTTCTCATACAAACACTTAAAATGTGTAAAATTCTTTTCCCCTATACTTAATATAAT
TGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan